SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g08831

Feature Type:gene_model
Chromosome:Gm06
Start:6451670
stop:6457126
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g08831
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G17210AT Annotation by Michelle Graham. TAIR10: heat stable protein 1 | chr3:5882318-5882896 FORWARD LENGTH=109 SoyBaseE_val: 2.00E-55ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
PF07876PFAM Stress responsive A/B Barrel Domain JGI ISS
UniRef100_G7JS72UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pop3 peptide n=1 Tax=Medicago truncatula RepID=G7JS72_MEDTR SoyBaseE_val: 1.00E-54ISS
UniRef100_I1JUU1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JUU1_SOYBN SoyBaseE_val: 3.00E-66ISS

Expression Patterns of Glyma06g08831
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g08831 not represented in the dataset
Glyma06g08831 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g08831
ParalogEvidenceComments
Glyma04g08730 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g08831 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma06g08831
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g08831
>Glyma06g08831.1   sequence type=CDS   gene model=Glyma06g08831   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGAAGCAAAGGGAGTTGTGAAGCACGTTTTCCTTGCAAAGTTCAAGGACGACGTCACTCCAGAGCGGATTGAGGAGCTCATCAAGGACTATGCCAATCTTGTCAATCTCATCCCACCCATGAAGTCATTCCATTGGGGCAAGGATGTAAGTGCTGAAAACATGCATCAAGGCTTCACTCATGTGTTTGAATCAGCCTTTGAGAGTACAGAAGGCCTTGCAGAGTATGTAGCTCATCCTGCCCATGTTGAATATGCAAATTTGCTCCTTCCTTGCCTGGAGAAAATCGTTGCGATTGACTACAAGCCTACCATCGTTAACCTTTGA
Predicted protein sequences of Glyma06g08831
>Glyma06g08831.1   sequence type=predicted peptide   gene model=Glyma06g08831   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEEAKGVVKHVFLAKFKDDVTPERIEELIKDYANLVNLIPPMKSFHWGKDVSAENMHQGFTHVFESAFESTEGLAEYVAHPAHVEYANLLLPCLEKIVAIDYKPTIVNL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo