SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g07900

Feature Type:gene_model
Chromosome:Gm06
Start:5811073
stop:5815473
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g07900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G31130AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF1218) | chr4:15137159-15138465 REVERSE LENGTH=195 SoyBaseE_val: 5.00E-85ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF06749PFAM Protein of unknown function (DUF1218) JGI ISS
UniRef100_C6T3Q0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T3Q0_SOYBN SoyBaseE_val: 2.00E-134ISS

Expression Patterns of Glyma06g07900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g07900
ParalogEvidenceComments
Glyma04g07830 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g07900 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g075200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g07900
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g07900
>Glyma06g07900.1   sequence type=CDS   gene model=Glyma06g07900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGTCACCGTCAAACTAATGGCTCTCATTGTTTCCTTTTTCGGCCTCTTGTCTTTCATTTTGGGAGTCATAGCCGAGAACAAAAAGCCTCCTGCTGGAATGCCCGTGCCCGTCAAGGATGGTGTGACATGCAAGTTCTCAGCCGATCTAACACTTGCATTGGGGTATCTTTCTGTAATTTTTCTTATTGCTTCCACAGTGGTTGGATATCTCTCTCTGTTTTACCCTTACAAAGGGAAAGCTGTTCCACAAAGAGTTCTCTTTAAAAGCACGACTTTCATGGTTTTCTTCAATGTTGCATTGTTTTCGACTGGACTAGCTCTAACTATGCTGTTATGGCCAACAATCACTGAACACCTTCACCTTAAACGCAATGTGCATCATGATCTCACATATACATGCCCCACTGCTAAAACTGGTCTCCTTGGAGGTGGTGCCTTTTTATCCCTTGATTCATCCCTCTTTTGGTTAGTTGCACTTATGCTGGCTGACAATGCTCGGGAGGATTTTTTGGATGAAGACAAAGATGTTGAACTTCCCTCACATGTTAATCATGCAGATATGGTCATATAG
Predicted protein sequences of Glyma06g07900
>Glyma06g07900.1   sequence type=predicted peptide   gene model=Glyma06g07900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVTVKLMALIVSFFGLLSFILGVIAENKKPPAGMPVPVKDGVTCKFSADLTLALGYLSVIFLIASTVVGYLSLFYPYKGKAVPQRVLFKSTTFMVFFNVALFSTGLALTMLLWPTITEHLHLKRNVHHDLTYTCPTAKTGLLGGGAFLSLDSSLFWLVALMLADNAREDFLDEDKDVELPSHVNHADMVI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo