Glyma06g07820 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g07820

Feature Type:	gene_model
Chromosome:	Gm06
Start:	5744571
stop:	5748302
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g07820

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G25570	AT	Annotation by Michelle Graham. TAIR10: unknown protein; Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). \| chr5:8901832-8902891 FORWARD LENGTH=99	SoyBase	E_val: 5.00E-25	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1K921	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K921_SOYBN	SoyBase	E_val: 1.00E-55	ISS

Expression Patterns of Glyma06g07820

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g07820

Paralog	Evidence	Comments
Glyma04g07740	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g07820 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g074500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g07820

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma06g07820

Limit To All Plant Sequences

>Glyma06g07820.3   sequence type=transcript   gene model=Glyma06g07820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCCTCATTTCGCTCCGAAGCAAGATTTGCATCAATGGCGTCCTCAGAGCCAATACCTCCAGAAGCAGAGCCCGAAAGCCACCTTTCTTCTCTCATCTACGAGATATCAAATGAAGTCCAAGGGATCATGGAGAACATGTTTAAGACTGTCACTGAAATTAATCAAAGTTCTGCTGTGGTAGAGGAGGAGATAGAGAAATGCAAAGGTTCTGCTCTCGAGAGGAAAAGAGCCTTAGATGAAGAGAAGGATAACTTTCAAAAAGCTGCTTATGCTGTTCTTGACATGCTCAGCAGAGAGTAAAACGCTCTAGCAGGTTACCGGAAAGAGCTTGAAGATTAAAAAAACCTCATTCTGTAAAGAAAACTTAATCTTCCAAATGACTTCTACCTCAGGTTAACGCATTAGTTGTCAATGTCATGCAGTCTATGATATTCTTTTATACAAGGATTCCCTGATTTCAGAGCTAAATCAATTACAGTTTTAAATCTTTAGTCCTAATGAGATTAATTTT

Coding sequences of Glyma06g07820

Limit To All Plant Sequences

>Glyma06g07820.2   sequence type=CDS   gene model=Glyma06g07820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTCCTCAGAGCCAATACCTCCAGAAGCAGAGCCCGAAAGCCACCTTTCTTCTCTCATCTACGAGATATCAAATGAAGTCCAAGGGATCATGGAGAACATGTTTAAGACTGTCACTGAAATTAATCAAAGTTCTGCTGTGGTAGAGGAGGAGATAGAGAAATGCAAAGGTTCTGCTCTCGAGAGGAAAAGAGCCTTAGATGAAGAGAAGGATAACTTTCAAAAAGCTGCTTATGCTGTTCTTGACATGCTCAGCAGAGAGTAA

>Glyma06g07820.3   sequence type=CDS   gene model=Glyma06g07820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTCCTCAGAGCCAATACCTCCAGAAGCAGAGCCCGAAAGCCACCTTTCTTCTCTCATCTACGAGATATCAAATGAAGTCCAAGGGATCATGGAGAACATGTTTAAGACTGTCACTGAAATTAATCAAAGTTCTGCTGTGGTAGAGGAGGAGATAGAGAAATGCAAAGGTTCTGCTCTCGAGAGGAAAAGAGCCTTAGATGAAGAGAAGGATAACTTTCAAAAAGCTGCTTATGCTGTTCTTGACATGCTCAGCAGAGAGTAA

Predicted protein sequences of Glyma06g07820

Limit To All Plant Sequences

>Glyma06g07820.2   sequence type=predicted peptide   gene model=Glyma06g07820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSEPIPPEAEPESHLSSLIYEISNEVQGIMENMFKTVTEINQSSAVVEEEIEKCKGSALERKRALDEEKDNFQKAAYAVLDMLSRE*

>Glyma06g07820.3   sequence type=predicted peptide   gene model=Glyma06g07820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSEPIPPEAEPESHLSSLIYEISNEVQGIMENMFKTVTEINQSSAVVEEEIEKCKGSALERKRALDEEKDNFQKAAYAVLDMLSRE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain