SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g07730

Feature Type:gene_model
Chromosome:Gm06
Start:5658297
stop:5663324
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g07730
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G11450AT Annotation by Michelle Graham. TAIR10: Mog1/PsbP/DUF1795-like photosystem II reaction center PsbP family protein | chr5:3654475-3656357 FORWARD LENGTH=297 SoyBaseE_val: 2.00E-114ISS
GO:0000023GO-bp Annotation by Michelle Graham. GO Biological Process: maltose metabolic process SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0045036GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to chloroplast SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009543GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0031977GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
PF01789PFAM PsbP JGI ISS
UniRef100_G7JBQ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: PsbP domain-containing protein n=1 Tax=Medicago truncatula RepID=G7JBQ7_MEDTR SoyBaseE_val: 1.00E-119ISS
UniRef100_I1K908UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K908_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma06g07730
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g07730
ParalogEvidenceComments
Glyma04g07610 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g07730 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g073600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g07730
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g07730
>Glyma06g07730.1   sequence type=CDS   gene model=Glyma06g07730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTTTTCCTTCCTCCTCCCTCTCCCTCTTCTTCCCCATTCCCACTCTGCTTCCTAATAACCTTATCTTCAGAAACAATACCAGGGCAATCCTTAATCAACACAAATGCCCATTCTCCGAGGAAAGACCACGCTTTTCATGTTGTGCTCTAAAACCCACTTCACAAAACAGGATTTTTAGAAGGGATTTGATGCTGTTAGGCCTTACTTCGTTATCTCCAACAATGCCACTTTCAGTGACACTTGCGGAAGAAGAACCAAAAATGGCTTCATTTCTTGACGAAATAAATGCCTATTCTTATATGTACCCTGTTGAGTTACCTTCCGATAATTTTACCTTCAAATGGATTGAATCCCGAAAGCCAGAACGATATTCATCAGCTGCACCACTTTCTCCTGATGCACGCCTGCGCATTGTGTCTGAGCGTCTTGACTTTATTGATAATGTCATCATTTCTGTCACGATAGGTCCACCAAATTCAAGCTATATAAAATCAAAGGATAAGAGTAAATGGACTGCAAAAGATGTTGCTGATTCAGTTTTAGCTGACAGATCTTCCCTGCGAGTTACCTCAAGTCAGCGCTTAGAAGAGAGTTCGGTTCTTAATACCCATTCTAGTGAAATTGATGGTGAGATGTACTGGTATTATGAATACCTTGTTCGTAAAGCACCTTTGAGACTTACCGACGAATCAAGCACTTACAGGCATTATCTTGCTTCAACAGCTGAAAGAGATGGTTATTTGTACTCTATCAGTGCTTCAACCGTCAGCCCTCTGTGGGAAAAACTGGGGCCTTTCCTTGATAAAGCGGTGAATTCGTTTCGTCTTCTTAGCCCAACAGAAAATTATGTTCCTCCGTACAAAGATCCCTGGAGATTTTGGTGA
Predicted protein sequences of Glyma06g07730
>Glyma06g07730.1   sequence type=predicted peptide   gene model=Glyma06g07730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVFPSSSLSLFFPIPTLLPNNLIFRNNTRAILNQHKCPFSEERPRFSCCALKPTSQNRIFRRDLMLLGLTSLSPTMPLSVTLAEEEPKMASFLDEINAYSYMYPVELPSDNFTFKWIESRKPERYSSAAPLSPDARLRIVSERLDFIDNVIISVTIGPPNSSYIKSKDKSKWTAKDVADSVLADRSSLRVTSSQRLEESSVLNTHSSEIDGEMYWYYEYLVRKAPLRLTDESSTYRHYLASTAERDGYLYSISASTVSPLWEKLGPFLDKAVNSFRLLSPTENYVPPYKDPWRFW*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo