Report for Sequence Feature Glyma06g07570
Feature Type: gene_model
Chromosome: Gm06
Start: 5503141
stop: 5506248
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g07570
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G11320 AT
Annotation by Michelle Graham. TAIR10: Flavin-binding monooxygenase family protein | chr5:3611429-3613361 REVERSE LENGTH=411
SoyBase E_val: 0 ISS
GO:0009851 GO-bp
Annotation by Michelle Graham. GO Biological Process: auxin biosynthetic process
SoyBase N/A ISS
GO:0009911 GO-bp
Annotation by Michelle Graham. GO Biological Process: positive regulation of flower development
SoyBase N/A ISS
GO:0010229 GO-bp
Annotation by Michelle Graham. GO Biological Process: inflorescence development
SoyBase N/A ISS
GO:0022603 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of anatomical structure morphogenesis
SoyBase N/A ISS
GO:0048825 GO-bp
Annotation by Michelle Graham. GO Biological Process: cotyledon development
SoyBase N/A ISS
GO:0048827 GO-bp
Annotation by Michelle Graham. GO Biological Process: phyllome development
SoyBase N/A ISS
GO:0055114 GO-bp
Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process
SoyBase N/A ISS
GO:2000024 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of leaf development
SoyBase N/A ISS
GO:0000139 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: Golgi membrane
SoyBase N/A ISS
GO:0005783 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum
SoyBase N/A ISS
GO:0005829 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosol
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0004497 GO-mf
Annotation by Michelle Graham. GO Molecular Function: monooxygenase activity
SoyBase N/A ISS
GO:0004499 GO-mf
Annotation by Michelle Graham. GO Molecular Function: N,N-dimethylaniline monooxygenase activity
SoyBase N/A ISS
GO:0016491 GO-mf
Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity
SoyBase N/A ISS
GO:0047434 GO-mf
Annotation by Michelle Graham. GO Molecular Function: indolepyruvate decarboxylase activity
SoyBase N/A ISS
GO:0050660 GO-mf
Annotation by Michelle Graham. GO Molecular Function: flavin adenine dinucleotide binding
SoyBase N/A ISS
GO:0050661 GO-mf
Annotation by Michelle Graham. GO Molecular Function: NADP binding
SoyBase N/A ISS
KOG1399
KOG
Flavin-containing monooxygenase
JGI ISS
PTHR23023 Panther
DIMETHYLANILINE MONOOXYGENASE
JGI ISS
PTHR23023:SF5 Panther
MONOOXYGENASE
JGI ISS
PF00743 PFAM
Flavin-binding monooxygenase-like
JGI ISS
PF01494 PFAM
FAD binding domain
JGI ISS
UniRef100_G7I6C3 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Dimethylaniline monooxygenase n=1 Tax=Medicago truncatula RepID=G7I6C3_MEDTR
SoyBase E_val: 0 ISS
UniRef100_I1K8Z1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K8Z1_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma06g07570
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma06g07570
Paralog Evidence Comments
Glyma04g07450 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g07570 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g072100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g07570
Coding sequences of Glyma06g07570
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g07570.1 sequence type=CDS gene model=Glyma06g07570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGTCCTTAAAGGCGCAAGAAGGAGGAGAGGAGCAAGTGAAGTGCGTGTGGGTTCATGGCCCTATCATCGTAGGAGCAGGACCCTCAGGGCTAGCCGTCGCCGCGTGCCTCTCCCACCACGGAGTACCCTACGTCATTCTCGAGAGAACAAACTGCATAACCTCACTTTGGCAACACAGAACCTACGACCGCCTCAAACTCCACCTCCCTAAACACTTCTGCGAACTCCCCTTAATACCCTTTCCCCTCCATTTCCCAAAATACCCCTCCAACTCCTACGCTTCACGCTTCAACATCCGCCCCAGGTTCAACCAGTCCGTTCAGACCGCCCAGTTCGACCCTTGTTCTCAGCTTTGGGTCGTCAAAACCAATGGTTTTCAGTACATTTCGCCGTGGCTTGTGGTTGCTACTGGAGAGAATGCTGAACCCGTTGTTCCCTCGATTTCTGGCATGGACAAGTTTCGCGGACCCATTGTTCACACCAGCGTCTATAAATCTGGTTCTGATTACAAGAACCAGAGGGTTTTGGTCATTGGTTGCGGCAACTCGGGTATGGAAGTTAGCTTGGATCTTTGCAGGCACAACGCCAACCCTTACATGGTTGCAAGAAACACAGTACATGTTTTGCCTATGGAGATGTTTGGGTTTTCGACGTTTGGAATAGCTATGGCTCTCTTGAAATGGCTTCCAATAAAGTTAGTAGACAAGTTGGTTTTGGCGGCGGCTAGGTTAATGTTGGGTGACACCGCTCGCTATGGCGTTAGAAGGCCCAAAACAGGGCCTATCGAGCTCAAACTAGTTACCGGGAAAACCCCTGTGCTTGATGTTGGACAAGTCGCTCAAATAAGATCCGGTAACATCAAGGTGATGGAAGGAGTGAAGGAGATAACAAGAAACGGTGCCAAGTTTATGGATGGACAAGAAAAGGAGTTCAGCGCTATAATATTGGCGACGGGATACAAAAGCAACGTGCCCACTTGGCTTAAGAGTTGTGAATCTTTCACGAAAGACGGAATGCCTAAAACGCCGTTTCCAATGGGTTGGAAGGGAGAGAACGGATTGTATACAGTGGGGTTCACGAGAAGAGGTCTTCTTGGAACTGCATCGGATGCCGTAAAAATTGCTAAAGACATCGCTGATCAATGGATGACCGTTAAGGACAGATCATACTGTAATTCCCACATCATCTTTCTCAAGAGTACATAG
Predicted protein sequences of Glyma06g07570
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g07570.1 sequence type=predicted peptide gene model=Glyma06g07570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MESLKAQEGGEEQVKCVWVHGPIIVGAGPSGLAVAACLSHHGVPYVILERTNCITSLWQHRTYDRLKLHLPKHFCELPLIPFPLHFPKYPSNSYASRFNIRPRFNQSVQTAQFDPCSQLWVVKTNGFQYISPWLVVATGENAEPVVPSISGMDKFRGPIVHTSVYKSGSDYKNQRVLVIGCGNSGMEVSLDLCRHNANPYMVARNTVHVLPMEMFGFSTFGIAMALLKWLPIKLVDKLVLAAARLMLGDTARYGVRRPKTGPIELKLVTGKTPVLDVGQVAQIRSGNIKVMEGVKEITRNGAKFMDGQEKEFSAIILATGYKSNVPTWLKSCESFTKDGMPKTPFPMGWKGENGLYTVGFTRRGLLGTASDAVKIAKDIADQWMTVKDRSYCNSHIIFLKST*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
