Report for Sequence Feature Glyma06g07520
Feature Type: gene_model
Chromosome: Gm06
Start: 5460963
stop: 5462847
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g07520
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G25605 AT
Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; Has 75 Blast hits to 75 proteins in 20 species: Archae - 2; Bacteria - 4; Metazoa - 0; Fungi - 0; Plants - 36; Viruses - 0; Other Eukaryotes - 33 (source: NCBI BLink). | chr2:10899541-10900875 FORWARD LENGTH=200
SoyBase E_val: 2.00E-103 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_G7JBN9 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: NAD(P)H-quinone oxidoreductase subunit H n=1 Tax=Medicago truncatula RepID=G7JBN9_MEDTR
SoyBase E_val: 9.00E-95 ISS
UniRef100_I1K8Y6 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K8Y6_SOYBN
SoyBase E_val: 6.00E-140 ISS
Expression Patterns of Glyma06g07520
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma06g07520
Paralog Evidence Comments
Glyma04g07410 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g07520 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g071600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g07520
Coding sequences of Glyma06g07520
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g07520.1 sequence type=CDS gene model=Glyma06g07520 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCGTTTGGGTCCTCTCTGTTGTCTCATTCGCATACCCTTCAATTCTTGTCCAACAGAAACAGAACCTCCCGCTTCAAAGCCACCGCCGAAGTTCCCGATTTCCTCTCTGCAGATTGGTTTGAATCTCGCAAGAAAAGACCCTTTGGCCCACGATTAGATTTTAGTGCAGAAGATGCGGTGCATTACCAGCTTGAAGCCTTGAAGTATAATGACCAGCCCCGTCCAGATTATGGAATCGAGGTTATGTACAGGTTTGCTGGATTTGATCCCTTTGAAAGGTCTCCCTATTTTGGCCCTTTCTTTGATTTGGGTCAGTTTGAAAGGTTTAGGCGCATTTTTCACCATTCTACTTATCGAGTCTTACTAGGTCACAAGGAGAGAAAGATCATGAGCACTTTGTTTGTCGAGGAGAACAAATACAAGCAGCGGGTTTGGATTCGTGGAAGTCGACCGGAGGAAGAGGAGATATTTCAATTTACAATGGCTCAGAAGGTTGGTGGATGCTGGGATGGTTACTGGTTAACAGAGTCTCTGCTTCACGATACTGATACATTTGCTGGTGGATTAGCATATTAA
Predicted protein sequences of Glyma06g07520
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g07520.1 sequence type=predicted peptide gene model=Glyma06g07520 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSFGSSLLSHSHTLQFLSNRNRTSRFKATAEVPDFLSADWFESRKKRPFGPRLDFSAEDAVHYQLEALKYNDQPRPDYGIEVMYRFAGFDPFERSPYFGPFFDLGQFERFRRIFHHSTYRVLLGHKERKIMSTLFVEENKYKQRVWIRGSRPEEEEIFQFTMAQKVGGCWDGYWLTESLLHDTDTFAGGLAY*