SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g07400

Feature Type:gene_model
Chromosome:Gm06
Start:5394382
stop:5396785
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g07400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G55190AT Annotation by Michelle Graham. TAIR10: RAN GTPase 3 | chr5:22392285-22393957 FORWARD LENGTH=221 SoyBaseE_val: 8.00E-166ISS
GO:0006184GO-bp Annotation by Michelle Graham. GO Biological Process: GTP catabolic process SoyBaseN/AISS
GO:0006406GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA export from nucleus SoyBaseN/AISS
GO:0006606GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into nucleus SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0006913GO-bp Annotation by Michelle Graham. GO Biological Process: nucleocytoplasmic transport SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0003924GO-mf Annotation by Michelle Graham. GO Molecular Function: GTPase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG0096 KOG GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily JGI ISS
PTHR24071Panther FAMILY NOT NAMED JGI ISS
PF00071PFAM Ras family JGI ISS
UniRef100_I1K8X7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K8X7_SOYBN SoyBaseE_val: 8.00E-165ISS
UniRef100_Q8H156UniRef Annotation by Michelle Graham. Most informative UniRef hit: GTP-binding nuclear protein Ran-3 n=1 Tax=Arabidopsis thaliana RepID=RAN3_ARATH SoyBaseE_val: 4.00E-163ISS

Expression Patterns of Glyma06g07400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g07400
ParalogEvidenceComments
Glyma04g07350 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g07400 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g070500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g07400
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g07400
>Glyma06g07400.1   sequence type=CDS   gene model=Glyma06g07400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTTGCCCAATCAGCAAACCGTCGATTACCCCAGCTTCAAGCTTGTCATCGTCGGCGACGGTGGCACAGGAAAGACAACCTTCGTGAAGAGGCATCTCACTGGTGAATTCGAGAAGAAATATGAACCGACCATTGGTGTGGAGGTTCATCCGTTGGATTTTTTCACGAACTGTGGAAAGATTCGCTTCTATTGTTGGGATACTGCTGGGCAAGAGAAGTTTGGTGGCCTCAGAGATGGATATTATATCCATGGGCAATGTGCGATTATCATGTTTGATGTTACTGCCCGTCTAACATACAAAAATGTCCCTACCTGGCACCGTGATCTTTGCCGGGTCTGTGAAAACATCCCAATTGTTCTTTGCGGTAACAAGGTTGATGTCAAGAATAGGCAAGTGAAGGCAAAGCAGGTTACTTTCCACAGGAAGAAGAATTTGCAGTACTATGAGATATCTGCTAAGAGCAACTACAATTTTGAAAAGCCATTTTTGTACTTGGCCAGGAAACTTGCAGGCGATGCTAACTTGCACTTTGTAGAATCTCCTGCATTGGCTCCACCAGAAGTTCAAATTGATTTAGCTGCACAACAACAGCACGAGGCTGAGCTTCTTGCAGCTGCTAGTCAGCCCCTTCCTGACGACGATGATGATCAATTTGAGTAG
Predicted protein sequences of Glyma06g07400
>Glyma06g07400.1   sequence type=predicted peptide   gene model=Glyma06g07400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPALAPPEVQIDLAAQQQHEAELLAAASQPLPDDDDDQFE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo