|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G18660 | AT | Annotation by Michelle Graham. TAIR10: plant natriuretic peptide A | chr2:8091032-8091644 REVERSE LENGTH=130 | SoyBase | E_val: 5.00E-21 | ISS |
| GO:0009627 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance | SoyBase | N/A | ISS |
| GO:0010230 | GO-bp | Annotation by Michelle Graham. GO Biological Process: alternative respiration | SoyBase | N/A | ISS |
| GO:0034976 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
| GO:0048046 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: apoplast | SoyBase | N/A | ISS |
| PF03330 | PFAM | Rare lipoprotein A (RlpA)-like double-psi beta-barrel | JGI | ISS | |
| UniRef100_G7JB40 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: EG45-like domain containing protein n=1 Tax=Medicago truncatula RepID=G7JB40_MEDTR | SoyBase | E_val: 2.00E-61 | ISS |
| UniRef100_I3RZF6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Lotus japonicus RepID=I3RZF6_LOTJA | SoyBase | E_val: 3.00E-63 | ISS |
|
Glyma06g07301 not represented in the dataset |
Glyma06g07301 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.06g069400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma06g07301.1 sequence type=CDS gene model=Glyma06g07301 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAGCTCTTCCTCTTTGTAATCTTTTCTAGCCTATTGCTCAAACAATTGAGCCTTGTTGTTGGAGACGTTGGCACTGCTGCTTCTTATGGACCACCGTACATACGTGACTACTGCTGTGATGGGAATAGGCCAGGGCAGTTTCCTCCTGGAAATCTATTTGTTGCGGTGAATGAAGGGTTATGGGATAACGGGGCAGCGTGTGGAAGGAGATACAGAATAAGGTGTGTGAGTGGAAACAATAGGCCATGCAAAGGTGGTAGCATCGATGTTAAAGTGGTAGATTCCTGTTCAAGGTCACCATGTCCCAACACCCTCCTCATGTCAAATGATGCATTTGCAGCTATTGCACGCTTCCCTCATGTTAAAATCAATATTGAATATACCCAGTAA
>Glyma06g07301.1 sequence type=predicted peptide gene model=Glyma06g07301 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKLFLFVIFSSLLLKQLSLVVGDVGTAASYGPPYIRDYCCDGNRPGQFPPGNLFVAVNEGLWDNGAACGRRYRIRCVSGNNRPCKGGSIDVKVVDSCSRSPCPNTLLMSNDAFAAIARFPHVKINIEYTQ*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||