Glyma06g07070 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g07070

Feature Type:	gene_model
Chromosome:	Gm06
Start:	5101538
stop:	5102795
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g07070

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G45180	AT	Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein \| chr2:18626377-18626781 FORWARD LENGTH=134	SoyBase	E_val: 5.00E-37	ISS
GO:0000038	GO-bp	Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid metabolic process	SoyBase	N/A	ISS
GO:0006869	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid transport	SoyBase	N/A	ISS
GO:0042335	GO-bp	Annotation by Michelle Graham. GO Biological Process: cuticle development	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0008289	GO-mf	Annotation by Michelle Graham. GO Molecular Function: lipid binding	SoyBase	N/A	ISS
PF00234	PFAM	Protease inhibitor/seed storage/LTP family	JGI		ISS
UniRef100_G7I719	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 14 kDa proline-rich protein DC2.15 n=1 Tax=Medicago truncatula RepID=G7I719_MEDTR	SoyBase	E_val: 5.00E-45	ISS
UniRef100_I1K8T4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K8T4_SOYBN	SoyBase	E_val: 2.00E-131	ISS

Expression Patterns of Glyma06g07070

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g07070

Paralog	Evidence	Comments
Glyma04g06970	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g07070 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g067000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g07070

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g07070

Limit To All Plant Sequences

>Glyma06g07070.1   sequence type=CDS   gene model=Glyma06g07070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCCAACAAACTCCTTGCCACCATTTTGGTGCTTTCTCTCCTCTTTTACTCAACATTCACTCATGCCAATTGCCCACCACCCACTCCAACTCCATCTCCATCTCCGAAGCCCACACCACCCACACCACCAACTCCAAAACCAACACCTCCCACTCCAAAGCCCACGCCACCAACTCCAAAACCAACACCACCCACTCCAAAGCCCACACCACCCACACCCACACCCACACCACCCACACCCAAGGCTGGTTGTCCTCCACCTTCTCCTCCGAAGCCCACACCACCCACACCACCAACTCCAAAACCAACACCACCCACACCCACACCCACACCCACACCACCCACACCACCCACACCCAAGGCTGGTTGTCCTCCACCTTCTCCTCCTTCGCCACCCAAAGCTTCATGCCCCAAGGACACATTAAAGCTAGGTGTTTGTGCTGACATCTTAGGACTTGTTAACGTTACTGTTGGAACTCCTCCTTCGAGCGAATGCTGTGCATTGGTTAAGGGTTTGGCAGATTTGGAAGCTGCACTTTGCCTATGCACCGCAATTAAGGCCAATGTGCTTGGAATAAACTTGAACGTACCTGTCACGCTCAGCGTGATCCTTAGTGCTTGTCAAAAAACTGTTCCTCCTGGTTTCCAATGTCCCTCCTAA

Predicted protein sequences of Glyma06g07070

Limit To All Plant Sequences

>Glyma06g07070.1   sequence type=predicted peptide   gene model=Glyma06g07070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASNKLLATILVLSLLFYSTFTHANCPPPTPTPSPSPKPTPPTPPTPKPTPPTPKPTPPTPKPTPPTPKPTPPTPTPTPPTPKAGCPPPSPPKPTPPTPPTPKPTPPTPTPTPTPPTPPTPKAGCPPPSPPSPPKASCPKDTLKLGVCADILGLVNVTVGTPPSSECCALVKGLADLEAALCLCTAIKANVLGINLNVPVTLSVILSACQKTVPPGFQCPS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain