Glyma06g06971 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g06971

Feature Type:	gene_model
Chromosome:	Gm06
Start:	5039069
stop:	5039381
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g06971

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G25290	AT	Annotation by Michelle Graham. TAIR10: Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein \| chr2:10766192-10768517 REVERSE LENGTH=745	SoyBase	E_val: 2.00E-25	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
PTHR22904	Panther	CHAPERONE BINDING PROTEIN	JGI		ISS
PTHR22904:SF25	Panther	TPR REPEAT CONTAINING PROTEIN	JGI		ISS
UniRef100_B9RP02	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Heat shock protein 70 (HSP70)-interacting protein, putative n=1 Tax=Ricinus communis RepID=B9RP02_RICCO	SoyBase	E_val: 2.00E-32	ISS
UniRef100_I1JUA6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JUA6_SOYBN	SoyBase	E_val: 8.00E-48	ISS

Expression Patterns of Glyma06g06971

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g06971 not represented in the dataset	Glyma06g06971 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g06971

Paralog	Evidence	Comments
Glyma04g06890	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g06971 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g066100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g06971

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g06971

Limit To All Plant Sequences

>Glyma06g06971.1   sequence type=CDS   gene model=Glyma06g06971   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGAAGCCCACAGGGAAGAAGGGTACCGTTACTCCAGGCGCTGCATATTCACACGCCATGCCCGGGAAATCTTCGAAAGCCTTCGATGAAGACACGGCGGTGTTCATGACCATGTCACAAGAGTTCAGGGAAGAAGGCAACAAGTTGTTTCAGAAGAAGGACCACGAAGGCGCCATGCTCAAGTACGAGAAGGCACTGAAGCTGCTCCCGAACAACCACATCGATGTTGCGCACCTTCGCACCAACATGGTCACGTGTTACAAGTGGCATCTTTATGCAATTTTCATCAGCATTGTTTTTCAATTCTAG

Predicted protein sequences of Glyma06g06971

Limit To All Plant Sequences

>Glyma06g06971.1   sequence type=predicted peptide   gene model=Glyma06g06971   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKPTGKKGTVTPGAAYSHAMPGKSSKAFDEDTAVFMTMSQEFREEGNKLFQKKDHEGAMLKYEKALKLLPNNHIDVAHLRTNMVTCYKWHLYAIFISIVFQF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain