Glyma06g06450 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g06450

Feature Type:	gene_model
Chromosome:	Gm06
Start:	4609250
stop:	4610403
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g06450

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G25060	AT	Annotation by Michelle Graham. TAIR10: early nodulin-like protein 14 \| chr2:10662308-10662930 FORWARD LENGTH=182	SoyBase	E_val: 1.00E-60	ISS
GO:0000226	GO-bp	Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization	SoyBase	N/A	ISS
GO:0000911	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation	SoyBase	N/A	ISS
GO:0016572	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone phosphorylation	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0031225	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane	SoyBase	N/A	ISS
GO:0046658	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
PF02298	PFAM	Plastocyanin-like domain	JGI		ISS
UniRef100_G7J9U0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Early nodulin-like protein n=1 Tax=Medicago truncatula RepID=G7J9U0_MEDTR	SoyBase	E_val: 1.00E-79	ISS
UniRef100_I1K8M1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K8M1_SOYBN	SoyBase	E_val: 2.00E-126	ISS

Expression Patterns of Glyma06g06450

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g06450

Paralog	Evidence	Comments
Glyma04g06410	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g06450 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g061200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g06450

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g06450

Limit To All Plant Sequences

>Glyma06g06450.1   sequence type=CDS   gene model=Glyma06g06450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGCTTGCTCAAGAACTTCTCTTTTGCTCCTTTTCTTTCTCTTTGGATTCTCCGCAGCTAAGGAACTATTGGTTGGAGGCAAAATAGATGCTTGGAAGATTCCATCTTCTGAATCAGATTCCCTCAATCAATGGGCTGAAAGGTCTCGTTTCAGAGTCGGCGATCATCTTGTGTGGAAATATGAGAATGGGAAGGACTCAGTGTTGGAAGTAACAAGGGAAGATTATGCCAATTGCAGCACATCCAAGCCCATCAAAGAGTACAATGATGGAAACACAAAGGTGAAGCTAGAGCATGCTGGTCCATTCTACTTCATAAGTGGAGCAAAGGGGCACTGTGAGAAGGGACAAAAGTTGATTGTGGTGGTTATGTCTCCAAGGCACATTATTTCTCCAGCACCTTCTCCAACAGAGTTCCACTTTGAGGGTCCCGCTGTAGCTCCTACTAGCAGTGCCACAACGTTTCAAGTTGGCCTACTCACTGCTCTTGGAGTTTTGGCCATGTATGTGGTTTTTCTCAAGTAA

Predicted protein sequences of Glyma06g06450

Limit To All Plant Sequences

>Glyma06g06450.1   sequence type=predicted peptide   gene model=Glyma06g06450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAACSRTSLLLLFFLFGFSAAKELLVGGKIDAWKIPSSESDSLNQWAERSRFRVGDHLVWKYENGKDSVLEVTREDYANCSTSKPIKEYNDGNTKVKLEHAGPFYFISGAKGHCEKGQKLIVVVMSPRHIISPAPSPTEFHFEGPAVAPTSSATTFQVGLLTALGVLAMYVVFLK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain