SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g06290

Feature Type:gene_model
Chromosome:Gm06
Start:4505246
stop:4506400
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g06290
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G57685AT Annotation by Michelle Graham. TAIR10: glutamine dumper 3 | chr5:23366356-23366802 REVERSE LENGTH=148 SoyBaseE_val: 2.00E-33ISS
GO:0009615GO-bp Annotation by Michelle Graham. GO Biological Process: response to virus SoyBaseN/AISS
GO:0019048GO-bp Annotation by Michelle Graham. GO Biological Process: virus-host interaction SoyBaseN/AISS
GO:0032940GO-bp Annotation by Michelle Graham. GO Biological Process: secretion by cell SoyBaseN/AISS
GO:0080143GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of amino acid export SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6T255UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T255_SOYBN SoyBaseE_val: 3.00E-117ISS
UniRef100_Q9FHH5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein GLUTAMINE DUMPER 3 n=1 Tax=Arabidopsis thaliana RepID=GDU3_ARATH SoyBaseE_val: 9.00E-31ISS

Expression Patterns of Glyma06g06290
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g06290
ParalogEvidenceComments
Glyma04g06230 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g06290 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g059500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g06290
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g06290
>Glyma06g06290.1   sequence type=CDS   gene model=Glyma06g06290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGAACCATCCCCACAACAACCTCAACTACAATAGCACCCACAGCCACCACGTCATCATTAACAACAAGTCCTTCTCAGCACTCCTCCACATGGCACTCTCCGGTTCCGTACCTGTTTGGAGGACTGGCTGCGATGCTCGGTCTCATAGCCTTTGCGCTTTTGATCTTAGCCTGCTCCTACTGGAAACTTTCTGGTCAGTTACAGAACGAGGAAAACGCCGAAAGGGACTTGGAAAGTGTTGTTGGTGGTGAGAAACAGGGTGACTCTGCAAACAAGGAATCAGTTACGGTGTACGAGGAGAAGATTCTCGTCATTATGGCCGGAGATGAGAAACCCACATTCTTGGCCACCCCGAAAGCCTCCTCCTTTGTCCCTCATGGTGTCCCCAACCATTTTGAGGAAAACCTCGAAAACCATGTGACTTCTGAGAAATCAGAGAAAAACCATGTTCAACAACCTACGTCTCCGCAACAACAGAGCCAGCCACGACAATAA
Predicted protein sequences of Glyma06g06290
>Glyma06g06290.1   sequence type=predicted peptide   gene model=Glyma06g06290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRTIPTTTSTTIAPTATTSSLTTSPSQHSSTWHSPVPYLFGGLAAMLGLIAFALLILACSYWKLSGQLQNEENAERDLESVVGGEKQGDSANKESVTVYEEKILVIMAGDEKPTFLATPKASSFVPHGVPNHFEENLENHVTSEKSEKNHVQQPTSPQQQSQPRQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo