SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g05850

Feature Type:gene_model
Chromosome:Gm06
Start:4191569
stop:4194347
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g05850
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G26340AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast thylakoid membrane, chloroplast thylakoid lumen, chloroplast; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; Has 38 Blast hits to 38 proteins in 13 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 38; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:11215254-11216480 FORWARD LENGTH=253 SoyBaseE_val: 6.00E-72ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009543GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1K8G2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K8G2_SOYBN SoyBaseE_val: 1.00E-163ISS
UniRef100_Q10R05UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q10R05_ORYSJ SoyBaseE_val: 1.00E-49ISS

Expression Patterns of Glyma06g05850
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g05850
ParalogEvidenceComments
Glyma04g05861 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g05850 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g055900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g05850
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g05850
>Glyma06g05850.1   sequence type=CDS   gene model=Glyma06g05850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTCACTAGGCACCCCAGCGCATGTTAGCAGTAACAAGAAGCCCTTGCATCGTTGGAGTTGGAAGGCGAAGCGTGTGAGGTGCGCAGTGTCACCCCCCACATGGCGTGAAGGGCGGCGCACGGTGTCGTTGTCTCTTGTTCTCTCCCACTTGCTTCTCATTCCTAACCGTGATACTGCCCTAGCAAGTCCTTTCGATAAGTATGTTAAGAGAAAAAAGCTTGATCCTCTGGAGGTTTATATACCAGCTGTCATACTTACAGAGTTTCAGATCAAGGACTTAGAAAAAACATTAGAGGATGAGGAACCCCAATTTGCCCTCTGCCGGTCTCTACTTCGTTCTGGGCCTGCAGCATCACTTCGTGTAAATATTAGAGCAGTGGCACAGTATGCATCTGACAGTGGCAATGGTAAAACGGCATTCAATGATGTTGATGAATGTCTGAGGTCGCTGGAAGAACTTGATTCCTTGCTTCTTCATGCATCAAGAAATGATCCTGAAGCCTCAGTCAAATCAATGAAGGCAAAAATCAATTCTGCCCTTGGCGCTCTGGACAGCCTCTTACAAACCGTACCTTCTGATGTGCTGAGTAAAGGAAAGGTTATAGCTGATTCATACAGGGAACCGGAAGACGAGGAAACAGGGAGTTTGGACCCTGATTTAAAGCAACTAGAATCAATACTATGA
Predicted protein sequences of Glyma06g05850
>Glyma06g05850.1   sequence type=predicted peptide   gene model=Glyma06g05850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASLGTPAHVSSNKKPLHRWSWKAKRVRCAVSPPTWREGRRTVSLSLVLSHLLLIPNRDTALASPFDKYVKRKKLDPLEVYIPAVILTEFQIKDLEKTLEDEEPQFALCRSLLRSGPAASLRVNIRAVAQYASDSGNGKTAFNDVDECLRSLEELDSLLLHASRNDPEASVKSMKAKINSALGALDSLLQTVPSDVLSKGKVIADSYREPEDEETGSLDPDLKQLESIL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo