Glyma06g05810 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g05810

Feature Type:	gene_model
Chromosome:	Gm06
Start:	4164130
stop:	4165038
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g05810

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G06520	AT	Annotation by Michelle Graham. TAIR10: photosystem II subunit X \| chr2:2587868-2588218 REVERSE LENGTH=116	SoyBase	E_val: 2.00E-26	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009523	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: photosystem II	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF06596	PFAM	Photosystem II reaction centre X protein (PsbX)	JGI		ISS
UniRef100_G7J8E2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ultraviolet-B-repressible protein n=1 Tax=Medicago truncatula RepID=G7J8E2_MEDTR	SoyBase	E_val: 1.00E-46	ISS
UniRef100_I1K8F8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K8F8_SOYBN	SoyBase	E_val: 1.00E-79	ISS

Expression Patterns of Glyma06g05810

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g05810

Paralog	Evidence	Comments
Glyma04g05800	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g05810 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g055500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g05810

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g05810

Limit To All Plant Sequences

>Glyma06g05810.1   sequence type=CDS   gene model=Glyma06g05810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTGCTTCTGTTCCCATGGCTTTCTCGCTGAGCTCTGTTATCAACAACAACAAGCCTTCATCCGAAGCCTTCTTCAGGCCACTACCCCTACGGCAACCAAAGAGGACCCTCTTCACCACAAAGGCAGTGTCAAACTCCAAGGCTCAAATCAATGCATCTTTGAAGGAGAAGGCAGTTGCAGGACTCACAGCAGCTTCTGTGACAGCATCTATGGTGGTTCCGGAGGTGGCTCATGCTGCTGGATATGAGTTCTCCCCTTCCCTCAAGAACTTTCTGCTAAGCATCTTTGCTGGTGGGTTTGTTCTAGTAGCCATATTTGGAGCCGTTATTGGGGTTTCCAACTTTGATCCGGTTAAGAGAACTTAA

Predicted protein sequences of Glyma06g05810

Limit To All Plant Sequences

>Glyma06g05810.1   sequence type=predicted peptide   gene model=Glyma06g05810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASASVPMAFSLSSVINNNKPSSEAFFRPLPLRQPKRTLFTTKAVSNSKAQINASLKEKAVAGLTAASVTASMVVPEVAHAAGYEFSPSLKNFLLSIFAGGFVLVAIFGAVIGVSNFDPVKRT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain