SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g05590

Feature Type:gene_model
Chromosome:Gm06
Start:4000294
stop:4001065
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g05590
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G11970AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF3511) | chr5:3863289-3863606 REVERSE LENGTH=105 SoyBaseE_val: 1.00E-31ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF12023PFAM Domain of unknown function (DUF3511) JGI ISS
UniRef100_C6SX84UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SX84_SOYBN SoyBaseE_val: 1.00E-77ISS

Expression Patterns of Glyma06g05590
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g05590 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g053300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g05590
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g05590
>Glyma06g05590.1   sequence type=CDS   gene model=Glyma06g05590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGAGTTTCAAAGATCAAGGTCTTATGCAAATGGGCAAATGATGCAGATAGAGAGCTACTATGGAGCCCCTAGGCCTTATGATCTCAGTCTCAGAACTTATAGTGCTTCCTATGCTCAAACTCATATGGGTCCTAATAGGGACTTGAAGTTGAAGAAAGGAAAAAGCATTTCTGCAGGGTCTTCTTTCTCTAAGTCTTGGAGCTTGGCTGATCCTGAGATTCGGAGGAAAAAGAGGATTGCTAGCTATAAAATGTATTCTGTGGAAGGAAAGATCAAAGGGTCCTTCAGAAAGAGCTTCAGGTGGCTTAAGAACAAGTACTCCCATGTGGTTTATGGCTGGTAG
Predicted protein sequences of Glyma06g05590
>Glyma06g05590.1   sequence type=predicted peptide   gene model=Glyma06g05590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEEFQRSRSYANGQMMQIESYYGAPRPYDLSLRTYSASYAQTHMGPNRDLKLKKGKSISAGSSFSKSWSLADPEIRRKKRIASYKMYSVEGKIKGSFRKSFRWLKNKYSHVVYGW*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo