Glyma06g05560 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g05560

Feature Type:	gene_model
Chromosome:	Gm06
Start:	3977106
stop:	3980201
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g05560

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G11950	AT	Annotation by Michelle Graham. TAIR10: Putative lysine decarboxylase family protein \| chr5:3855072-3856815 FORWARD LENGTH=216	SoyBase	E_val: 1.00E-125	ISS
GO:0009089	GO-bp	Annotation by Michelle Graham. GO Biological Process: lysine biosynthetic process via diaminopimelate	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0042803	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein homodimerization activity	SoyBase	N/A	ISS
PF03641	PFAM	Possible lysine decarboxylase	JGI		ISS
UniRef100_G7I9V5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Lysine decarboxylase-like protein n=1 Tax=Medicago truncatula RepID=G7I9V5_MEDTR	SoyBase	E_val: 1.00E-135	ISS
UniRef100_I1K8D8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K8D8_SOYBN	SoyBase	E_val: 1.00E-156	ISS

Expression Patterns of Glyma06g05560

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g05560

Paralog	Evidence	Comments
Glyma04g05550	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g05560 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g053000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g05560

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g05560

Limit To All Plant Sequences

>Glyma06g05560.1   sequence type=CDS   gene model=Glyma06g05560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGAAGGGTACCCCAGAAGCAAGTTCAAGACCGTGTGTGTCTTCTGTGGCAGCAACAGTGGCAACCGACAAGTCTTCAGTGACGCTGCGATTCAATTGGGCAATGAACTGGTTAAGAGGAACATAGACTTGGTGTATGGTGGGGGCAGTGTTGGGCTAATGGGCTTAATATCTCAGAGAGTGTATGATGGAGGCTGCCATGTCCTAGGGATCATTCCAAAAGCTCTCATGCCTCTCGAGATATCAGGTGAAACAGTAGGTGAAGTGAGAATTGTTTCAGATATGCACGAGCGTAAAGCTGCCATGGCTCAAGAAGCTGATGCATTTGTTGCTCTCCCTGGAGGATATGGAACCATGGAGGAGCTGTTGGAGATGATAACTTGGGCCCAACTTGGAATCCATAAAAAACCGGTTGGTCTACTGAATGTTGACGGTTACTATAACTGTTTGCTTGCATTATTTGACAATGGTGTTAAAGAAGGCTTCATTAAGCCTTGTGCACGGGATATAGTTGTCTCTGCTACGTCAGCCAAAGAACTTATGATGAAGATGGAGCACTACACTCCTTCGCACGAACATGTTGCCCCTCATGAGAGCTGGCAGATGAAGCAATTAGGTAATTATCCAGATGCAGAGTGA

Predicted protein sequences of Glyma06g05560

Limit To All Plant Sequences

>Glyma06g05560.1   sequence type=predicted peptide   gene model=Glyma06g05560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEEGYPRSKFKTVCVFCGSNSGNRQVFSDAAIQLGNELVKRNIDLVYGGGSVGLMGLISQRVYDGGCHVLGIIPKALMPLEISGETVGEVRIVSDMHERKAAMAQEADAFVALPGGYGTMEELLEMITWAQLGIHKKPVGLLNVDGYYNCLLALFDNGVKEGFIKPCARDIVVSATSAKELMMKMEHYTPSHEHVAPHESWQMKQLGNYPDAE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain