Glyma06g05510 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g05510

Feature Type:	gene_model
Chromosome:	Gm06
Start:	3931186
stop:	3932654
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g05510

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G33040	AT	Annotation by Michelle Graham. TAIR10: Thioredoxin superfamily protein \| chr4:15940779-15941213 REVERSE LENGTH=144	SoyBase	E_val: 5.00E-53	ISS
GO:0045454	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis	SoyBase	N/A	ISS
GO:0048653	GO-bp	Annotation by Michelle Graham. GO Biological Process: anther development	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0015035	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity	SoyBase	N/A	ISS
KOG1752	KOG	Glutaredoxin and related proteins	JGI		ISS
PTHR10168	Panther	GLUTAREDOXIN	JGI		ISS
PTHR10168:SF47	Panther	GLUTAREDOXIN	JGI		ISS
PF00462	PFAM	Glutaredoxin	JGI		ISS
UniRef100_I1K8D4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K8D4_SOYBN	SoyBase	E_val: 2.00E-95	ISS
UniRef100_Q8L9S3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Glutaredoxin-C6 n=1 Tax=Arabidopsis thaliana RepID=GRXC6_ARATH	SoyBase	E_val: 2.00E-50	ISS

Expression Patterns of Glyma06g05510

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g05510

Paralog	Evidence	Comments
Glyma04g05490	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g05510 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g052600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g05510

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g05510

Limit To All Plant Sequences

>Glyma06g05510.1   sequence type=CDS   gene model=Glyma06g05510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACAGTACTGAGGAGGGGATGCAAGGCATAGGCATAGGCATAGGCTGCTTCCAAAACGACGTCGTAGGGCAGCTGGAGCTGAGTCCCACTATGAGCAACTCCTCCTCCTCGCTATCCATGGAGCTGGACGAGTCCCCGGAGAGCAGAATCCAACGGTTGATATCGGAGCACCCGGTCATCATCTTCACCCGATCCTCCTGCTGCATGTGCCACGTCATGAAGAAGCTCCTCGCCACCATCGGCGTCCACCCCACCGTCATCGAATTGGACGACCAGGAGATCGCCGCCCTCCCCGACACCAGCGCCCCCTCGGCCTTTATAGGCGGCACCTGCATCGGCGGCCTCGAATCCCTGGTCGGCCTCCACGTCACCGGCCACCTGATCCCCAAACTGGTCCAAGTCGGCGCTCTCTGGGTATGA

Predicted protein sequences of Glyma06g05510

Limit To All Plant Sequences

>Glyma06g05510.1   sequence type=predicted peptide   gene model=Glyma06g05510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNSTEEGMQGIGIGIGCFQNDVVGQLELSPTMSNSSSSLSMELDESPESRIQRLISEHPVIIFTRSSCCMCHVMKKLLATIGVHPTVIELDDQEIAALPDTSAPSAFIGGTCIGGLESLVGLHVTGHLIPKLVQVGALWV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain