Report for Sequence Feature Glyma06g05490
Feature Type: gene_model
Chromosome: Gm06
Start: 3913528
stop: 3914927
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g05490
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G11890 AT
Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; LOCATED IN: plasma membrane; EXPRESSED IN: 12 plant structures; EXPRESSED DURING: 6 growth stages; BEST Arabidopsis thaliana protein match is: Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (TAIR:AT1G17620.1); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). | chr5:3831770-3832633 FORWARD LENGTH=287
SoyBase E_val: 3.00E-59 ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF03168 PFAM
Late embryogenesis abundant protein
JGI ISS
UniRef100_A2Q440 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Harpin-induced 1 n=1 Tax=Medicago truncatula RepID=A2Q440_MEDTR
SoyBase E_val: 1.00E-50 ISS
UniRef100_I1K8D2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K8D2_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma06g05490
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma06g05490
Paralog Evidence Comments
Glyma04g05460 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g05490 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g052400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g05490
Coding sequences of Glyma06g05490
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g05490.1 sequence type=CDS gene model=Glyma06g05490 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCTGACCCAGCCTCCAAACCCAGCGGAAACGGCGCGGCCGCCACTAACGGCAATCCCGGACCCGTCAAGTCTCAACTCTACAACCCCAACCGTCAAGTTTACCGCCCGCAATCACACTACCACCGTCGCGGCCAACGCTCCCACCGTAACCTCTGCTGCTGCTGCTGCTTCTGGACCATCCTCACCCTCCTCGCGGTGGCCCTCCTCGCTGCCATTGTCGGCGCCGCACTCTACGTACTCTACCGCCCTCACCGTCCCGAATTCTCCGTCACAAACCTCCGCATTGCAAAGATGAACCTCACAACCTCCGCGGACTCACCTTCACACCTCACTACGCTCTTCAACCTCACTCTCATCGCCAAGAACCCTAACAACCACCTCGTCTTCTTCTACGACCCGTTCTCCGTGACGGTGCTCTCGAACTCTGTCCCCGTTGGGAACGGTTCCGTTACGGCGTTTACCTCCGACAAGAACAACCAAACGAGCCTCCGCGCGGTGCTGTCGGGGTCGCAAGATCTGGACACGGACTCGTTGACTAGCCTGAGATCGGGGCTGAAGATGAAGAGAGGGTTCCCCGTTGAGATTCAGATGGACACCAAGGTGAAGATGAAGATGGATTGGCTCAAGAGCAAGAAAGTCGGAATTAGAGTCACCTGCGACGGAATCAGAGGAACCGTTCCCTCCGGCAAAACTCCGGCGGTGGCCTCCGTCGTCGACTCCGAGTGTAAGGTGGATCTTCGAATCAAGATCTGGAAGTTCTCCTTTTAA
Predicted protein sequences of Glyma06g05490
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g05490.1 sequence type=predicted peptide gene model=Glyma06g05490 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSDPASKPSGNGAAATNGNPGPVKSQLYNPNRQVYRPQSHYHRRGQRSHRNLCCCCCFWTILTLLAVALLAAIVGAALYVLYRPHRPEFSVTNLRIAKMNLTTSADSPSHLTTLFNLTLIAKNPNNHLVFFYDPFSVTVLSNSVPVGNGSVTAFTSDKNNQTSLRAVLSGSQDLDTDSLTSLRSGLKMKRGFPVEIQMDTKVKMKMDWLKSKKVGIRVTCDGIRGTVPSGKTPAVASVVDSECKVDLRIKIWKFSF*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
