Glyma06g05300 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g05300

Feature Type:	gene_model
Chromosome:	Gm06
Start:	3789476
stop:	3791072
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g05300

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G19810	AT	Annotation by Michelle Graham. TAIR10: CCCH-type zinc finger family protein \| chr2:8550419-8551498 FORWARD LENGTH=359	SoyBase	E_val: 4.00E-78	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006661	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process	SoyBase	N/A	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0015996	GO-bp	Annotation by Michelle Graham. GO Biological Process: chlorophyll catabolic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR14493	Panther	UNKEMPT-RELATED	JGI		ISS
PF00642	PFAM	Zinc finger C-x8-C-x5-C-x3-H type (and similar)	JGI		ISS
UniRef100_G7J714	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger CCCH domain-containing protein n=1 Tax=Medicago truncatula RepID=G7J714_MEDTR	SoyBase	E_val: 2.00E-88	ISS
UniRef100_I1K8B1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K8B1_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma06g05300

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g05300 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g050300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g05300

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g05300

Limit To All Plant Sequences

>Glyma06g05300.1   sequence type=CDS   gene model=Glyma06g05300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCCCAAACGTTGAAATCCCTCACTGGGACGCCGACGGAGGAGGACCACTCTCTCCGTTCATCTCTTCTTCTTCCAATGCTGACAAGTGCTCATTATTATTCTCCTCCGACCATTTCCGAATGTTCCAGTTCAAGGTCCGGATCTGTCCACGTGGCAGGTCCCACGATTGGACGGAGTGTCCCTACGCCCACCCTGCCGAGAAGGCTCGCCGCCGTGACCCCCGCAAGTACCACTACTCCGGCACCGCCTGCCCCGATTACCAGAAGGGGAACTGCAAGAGGGGCGACACTTGTCAGTTCTCGCACGGCGTCTTCGAATGCTGGCTCCATCCTTCTCGCTACCGGACCCACCTCTGCAAAGACGGAACCACTTGCCGCCGCAGAGTCTGCTTCTTCGCTCACACCACCGAACAACTCCGCCTCGTAGTAACGGATTCATCATCGTCCTCCTTTGTTTCCTCTCCCACTTCGGTCCTCAACTCTTCGTCCTTCTCCGATTCTTCGCCGTACAGCTTCGTGCGCGAAATAGTTAACTCAACGCGGAATGTTAAAATCGAGGATTCGGGTTTGACCCGTTGCGTGTTTGGGTCGCCACGTGGCGGGTTTTTAAGTGTGAATGGGTGCGAGGAGGAGCCTGCTATGGAGAGGGTGGAATCTGGGAAAGACATTAGAGCGAGAATCTATGCCAAGCTTAGTAGGGAGAACACGATTGGAGCCTCTGACCCTGACATTGGATGGGTTTCGGAACTCGTCAAATGA

Predicted protein sequences of Glyma06g05300

Limit To All Plant Sequences

>Glyma06g05300.1   sequence type=predicted peptide   gene model=Glyma06g05300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIPNVEIPHWDADGGGPLSPFISSSSNADKCSLLFSSDHFRMFQFKVRICPRGRSHDWTECPYAHPAEKARRRDPRKYHYSGTACPDYQKGNCKRGDTCQFSHGVFECWLHPSRYRTHLCKDGTTCRRRVCFFAHTTEQLRLVVTDSSSSSFVSSPTSVLNSSSFSDSSPYSFVREIVNSTRNVKIEDSGLTRCVFGSPRGGFLSVNGCEEEPAMERVESGKDIRARIYAKLSRENTIGASDPDIGWVSELVK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain