SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g05111

Feature Type:gene_model
Chromosome:Gm06
Start:3608769
stop:3609912
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g05111
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G49760AT Annotation by Michelle Graham. TAIR10: basic leucine-zipper 5 | chr3:18455569-18456039 REVERSE LENGTH=156 SoyBaseE_val: 2.00E-16ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009410GO-bp Annotation by Michelle Graham. GO Biological Process: response to xenobiotic stimulus SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
PF07716PFAM Basic region leucine zipper JGI ISS
UniRef100_B9R6W5UniRef Annotation by Michelle Graham. Most informative UniRef hit: DNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9R6W5_RICCO SoyBaseE_val: 9.00E-30ISS
UniRef100_I1JTS9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JTS9_SOYBN SoyBaseE_val: 4.00E-66ISS

Expression Patterns of Glyma06g05111
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g05111 not represented in the dataset
Glyma06g05111 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g05111
ParalogEvidenceComments
Glyma04g05030 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g05111 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g048500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g05111
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g05111
>Glyma06g05111.1   sequence type=CDS   gene model=Glyma06g05111   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTTTCCACCAAGATGAAGCGGTTCAGTACCCGTGCACTCCAGTTCACGAGACCATGCTGACCGAAAGCGAAATAGAAGACTTGTTTTCTCTCATTAACCATTCGACAGACCCGGCTAGCCCGGGGTCCGGTTCCCAGGGTTCAAACCGGGTGGTTTACTCGCCAGAGGAACGAAAGCTGAGACGCATGCAATCGAACCGGGAATCGGCCCGAAGGTCCCGCTACAGAAAGAAGCAGCATATAGAGAACCTCACGAGCCAACTGAACCGGTTGAGAATCCAAAACCGATTACTCAAAAACCAACTCGCCTCCACCATGCACCAGAACCTCCTACTATCCCTACATAACGACCATCTTAAATCCGAATCCGTTGCCCTTATGGCCACACTTTCGGATCTGTGTGGGATTTTAGGCACCATGCTTTCACATTAA
Predicted protein sequences of Glyma06g05111
>Glyma06g05111.1   sequence type=predicted peptide   gene model=Glyma06g05111   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFFHQDEAVQYPCTPVHETMLTESEIEDLFSLINHSTDPASPGSGSQGSNRVVYSPEERKLRRMQSNRESARRSRYRKKQHIENLTSQLNRLRIQNRLLKNQLASTMHQNLLLSLHNDHLKSESVALMATLSDLCGILGTMLSH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo