|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G49780 | AT | Annotation by Michelle Graham. TAIR10: phytosulfokine 4 precursor | chr3:18465750-18466254 FORWARD LENGTH=79 | SoyBase | E_val: 4.00E-15 | ISS |
GO:0008283 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell proliferation | SoyBase | N/A | ISS |
GO:0009887 | GO-bp | Annotation by Michelle Graham. GO Biological Process: organ morphogenesis | SoyBase | N/A | ISS |
GO:0030154 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell differentiation | SoyBase | N/A | ISS |
GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
GO:0031012 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular matrix | SoyBase | N/A | ISS |
GO:0008083 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: growth factor activity | SoyBase | N/A | ISS |
PF06404 | PFAM | Phytosulfokine precursor protein (PSK) | JGI | ISS | |
UniRef100_B9SH34 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Phytosulfokines, putative n=1 Tax=Ricinus communis RepID=B9SH34_RICCO | SoyBase | E_val: 1.00E-16 | ISS |
UniRef100_B9SH34 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Phytosulfokines, putative n=1 Tax=Ricinus communis RepID=B9SH34_RICCO | SoyBase | E_val: 1.00E-16 | ISS |
Glyma06g05081 not represented in the dataset |
Glyma06g05081 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.06g048200 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma06g05081.1 sequence type=CDS gene model=Glyma06g05081 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTCTAAACTGGCCACCTTCTTGTATCTTCTCATTTGCTTCGGCTTAACCTATGCCTCTCGTCCTAACGTTGAGTTCGACGCAATCATTTCACCGCACAGGGATGTTTCGGCATACAAAACAGCCTTAGCAGTGTTGGACGATGAGAGTTGCGAAGGAATAGACGGGAGTGAGGAATGTTTGATGAGAAGAACTCTAGTGGCTCATGTTGATTATATCTACACTCAAAAGCATAAACCATAA
>Glyma06g05081.1 sequence type=predicted peptide gene model=Glyma06g05081 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSKLATFLYLLICFGLTYASRPNVEFDAIISPHRDVSAYKTALAVLDDESCEGIDGSEECLMRRTLVAHVDYIYTQKHKP*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||