SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma06g05030

Feature Type:gene_model
Chromosome:Gm06
Start:3558639
stop:3560098
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G58420AT Annotation by Michelle Graham. TAIR10: Uncharacterised conserved protein UCP031279 | chr1:21707407-21707946 FORWARD LENGTH=179 SoyBaseE_val: 7.00E-21ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6TB21UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TB21_SOYBN SoyBaseE_val: 7.00E-111ISS
UniRef100_Q75KB0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q75KB0_ORYSJ SoyBaseE_val: 9.00E-10ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g04940 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g047600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g05030.1   sequence type=CDS   gene model=Glyma06g05030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGAAGGGGAACAAGAAGAAGAACAAGCTGGTGTGGATGATAGCGACGCCGTTTAGGGTGTTGGGGAAAGCGAGGGACATGTACGTGAGCAGCATAACGAAGTGCGGTCACAACATGAATTACAGCAACCCCGTGGATGCTGCTGGCAGATTCCAGGCTTTGCCCAGGAGTTACAGTGCTGCCACGTCACGCTCCGACAACAACGAGGATTTCGCCGAACTTTTGAGAGCGGCTTCCGCCAGGACTTTGGGCAACATAATCGATGTAGATTTGGTTGTAAAACAGCAGGCCCAAACCCAGACCCGGCCCGTTTCCTCAAATGGGTTGCCCAAGTCGACGAGCGTTGGCATGGGCCGGATCGACGAGGACACGCCTTATGATTTGGGGGAAGGGGAAGTTCCCGTTGTGCCCAAAGCCTATCCAAGAAGTAGAAGCTATGCTGTTGGAAAGACAAGTGCTGTTTTGTAA

>Glyma06g05030.1   sequence type=predicted peptide   gene model=Glyma06g05030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRKGNKKKNKLVWMIATPFRVLGKARDMYVSSITKCGHNMNYSNPVDAAGRFQALPRSYSAATSRSDNNEDFAELLRAASARTLGNIIDVDLVVKQQAQTQTRPVSSNGLPKSTSVGMGRIDEDTPYDLGEGEVPVVPKAYPRSRSYAVGKTSAVL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo