SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g04775): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g04775): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g04775

Feature Type:gene_model
Chromosome:Gm06
Start:3372319
stop:3376762
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G48810AT Annotation by Michelle Graham. TAIR10: cytochrome B5 isoform D | chr5:19789249-19790180 REVERSE LENGTH=140 SoyBaseE_val: 3.00E-30ISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0019745GO-bp Annotation by Michelle Graham. GO Biological Process: pentacyclic triterpenoid biosynthetic process SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005789GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum membrane SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
KOG4576 KOG Sulfite oxidase, heme-binding component JGI ISS
PTHR19359Panther CYTOCHROME B5 JGI ISS
PF00173PFAM Cytochrome b5-like Heme/Steroid binding domain JGI ISS
UniRef100_G7ZXK9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome B5 n=1 Tax=Medicago truncatula RepID=G7ZXK9_MEDTR SoyBaseE_val: 5.00E-79ISS
UniRef100_I1K846UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K846_SOYBN SoyBaseE_val: 9.00E-86ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g04775 not represented in the dataset

Glyma06g04775 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g04695 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g04775.1   sequence type=CDS   gene model=Glyma06g04775   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTATTACAACCTTCAACGGAACCGGCGTTGGATTTGGTTTCGGCGTAGGTTGCGGTTTCGGTATAGGATGGGGTTTCGGAGGTATGCCATTGAACTTATTGGGTCTTGGTGCAGGTGGAGGTTGTGGCGTTGGAGTAGGGCTTGGTTGGGGGTTTGGTACTGCCTTTGGTAGCAAGTATCGTTCCTCACGGGTCACATTTCAAGGAGTGGATTTTGATAGCAAGGAGAAAGTTAACAGCACGGAGTTGTCAAAACCCAGGACCGAAGTTGCCCAACATAAATCCAACAAAGACTGTTGGCTTGTGATCAATGGCAGGGTGTTGGACGTGACAAAGTTCTTGGAGGAACACCCGGGAGGGGAAGAGGTGATTCTAGAGGTAGCTGGGAAGGATGCGACAAAGGAGTTTGATGTTATTGGACACAGCAAAGCAGCGCAAAACATGGTCCTAAAGTACCAAGTGGGTGTCCTCCAAGGTGCCACAGTTCAAGAGGTGAAGGATGTTGTCGACAAGGAATCCGACACCAAAGAGATGAGTGCCTTCGTGATCAAAGAGAGTGCAAGGTCTAAGTCCCTCGTTTTTTACGAGTTCTTTGTTCCACTTCTTGTAGCTGCACTCTATTTTGGTTACCGATGTCTCACTTACTAG

>Glyma06g04775.1   sequence type=predicted peptide   gene model=Glyma06g04775   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVITTFNGTGVGFGFGVGCGFGIGWGFGGMPLNLLGLGAGGGCGVGVGLGWGFGTAFGSKYRSSRVTFQGVDFDSKEKVNSTELSKPRTEVAQHKSNKDCWLVINGRVLDVTKFLEEHPGGEEVILEVAGKDATKEFDVIGHSKAAQNMVLKYQVGVLQGATVQEVKDVVDKESDTKEMSAFVIKESARSKSLVFYEFFVPLLVAALYFGYRCLTY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo