SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g04751): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g04751): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g04751

Feature Type:gene_model
Chromosome:Gm06
Start:3360715
stop:3361740
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G33430AT Annotation by Michelle Graham. TAIR10: differentiation and greening-like 1 | chr2:14162732-14164729 FORWARD LENGTH=219 SoyBaseE_val: 3.00E-16ISS
GO:0000478GO-bp Annotation by Michelle Graham. GO Biological Process: endonucleolytic cleavage involved in rRNA processing SoyBaseN/AISS
GO:0002103GO-bp Annotation by Michelle Graham. GO Biological Process: endonucleolytic cleavage of tetracistronic rRNA transcript (SSU-rRNA, LSU-rRNA, 4.5S-rRNA, 5S-rRNA) SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006399GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA metabolic process SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0009658GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast organization SoyBaseN/AISS
GO:0009902GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast relocation SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0034660GO-bp Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0042793GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1K842UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K842_SOYBN SoyBaseE_val: 5.00E-33ISS
UniRef100_Q01HT4UniRef Annotation by Michelle Graham. Most informative UniRef hit: B0403H10-OSIGBa0105A11.14 protein n=3 Tax=Oryza sativa RepID=Q01HT4_ORYSA SoyBaseE_val: 9.00E-14ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g04751 not represented in the dataset

Glyma06g04751 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g04751.1   sequence type=CDS   gene model=Glyma06g04751   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGTCGCTGTTCAAGGGCTGTGACTACCATCATTGGCTCGTCGTCATCCATGAGTCCGCCGGCAAAGGCTGCACCAAGCCACAAATGATTGATTGCTACATTCAAACCCTCGCCAAGGTTCTTGGAAGTTCAAGTTCCCCCCCTCTAGTTCTTCCAAATTCAAGATTTGTTCTGAGATTTTTGTTGTTTCCGTTTTTATCAAGTTTTTGTTTCCATGGTTTTGGAGGTAGAAGAATAGGAAAAGAATGTGTTGATGTCGCGGTGGGTTCTTACATGGTGTTGTCAAAGGAGTCTACAGGGTGTTGTGAATTGGGGCATGATGCAGGTTGGTTCTTACAGAACTTTTATCAGACATTTGGTGAGCACTGGAATAACGACTAA

>Glyma06g04751.1   sequence type=predicted peptide   gene model=Glyma06g04751   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVSLFKGCDYHHWLVVIHESAGKGCTKPQMIDCYIQTLAKVLGSSSSPPLVLPNSRFVLRFLLFPFLSSFCFHGFGGRRIGKECVDVAVGSYMVLSKESTGCCELGHDAGWFLQNFYQTFGEHWNND*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo