Glyma06g04740 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g04740

Feature Type:	gene_model
Chromosome:	Gm06
Start:	3354853
stop:	3355862
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g04740

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G59845	AT	Annotation by Michelle Graham. TAIR10: Gibberellin-regulated family protein \| chr5:24111443-24111808 FORWARD LENGTH=89	SoyBase	E_val: 2.00E-34	ISS
GO:0009739	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF02704	PFAM	Gibberellin regulated protein	JGI		ISS
UniRef100_B9R733	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: GAST1 protein, putative n=1 Tax=Ricinus communis RepID=B9R733_RICCO	SoyBase	E_val: 5.00E-40	ISS
UniRef100_C6SY10	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SY10_SOYBN	SoyBase	E_val: 7.00E-56	ISS

Expression Patterns of Glyma06g04740

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g04740 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g044400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g04740

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g04740

Limit To All Plant Sequences

>Glyma06g04740.1   sequence type=CDS   gene model=Glyma06g04740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCTCGAGTTCGCAAATGTGCTACTTCTGTGCCTTGTCCTTAGCTCTTCTTTCTTGGAAATCTCAATGGCTGGTTCTCCTTTCTGTGACTCAAAGTGCGCGCAGAGGTGTGCCAAAGCTGGGGTTCAGGACAGATGCTTGAGGTTTTGCGGGATCTGCTGCGAGAAGTGCAACTGTGTCCCATCTGGGACTTACGGAAACAAGGACGAGTGCCCTTGCTACAGGGACATGAAGAACTCCAAGGGCAAGGACAAATGCCCTTGA

Predicted protein sequences of Glyma06g04740

Limit To All Plant Sequences

>Glyma06g04740.1   sequence type=predicted peptide   gene model=Glyma06g04740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKLEFANVLLLCLVLSSSFLEISMAGSPFCDSKCAQRCAKAGVQDRCLRFCGICCEKCNCVPSGTYGNKDECPCYRDMKNSKGKDKCP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain