SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g04540

Feature Type:gene_model
Chromosome:Gm06
Start:3207650
stop:3210693
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g04540
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G47128AT Annotation by Michelle Graham. TAIR10: Granulin repeat cysteine protease family protein | chr1:17283139-17285609 REVERSE LENGTH=462 SoyBaseE_val: 3.00E-49ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0015996GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll catabolic process SoyBaseN/AISS
GO:0042744GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008233GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidase activity SoyBaseN/AISS
GO:0008234GO-mf Annotation by Michelle Graham. GO Molecular Function: cysteine-type peptidase activity SoyBaseN/AISS
KOG1543 KOG Cysteine proteinase Cathepsin L JGI ISS
PTHR12411Panther CYSTEINE PROTEASE FAMILY C1-RELATED JGI ISS
PTHR12411:SF44Panther CATHEPSIN L-RELATED JGI ISS
PF00112PFAM Papain family cysteine protease JGI ISS
UniRef100_I1K820UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K820_SOYBN SoyBaseE_val: 0ISS
UniRef100_O24323UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cysteine proteinase n=1 Tax=Phaseolus vulgaris RepID=O24323_PHAVU SoyBaseE_val: 4.00E-59ISS

Expression Patterns of Glyma06g04540
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g04540
ParalogEvidenceComments
Glyma04g04400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g04540 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma06g04540
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g04540
>Glyma06g04540.1   sequence type=CDS   gene model=Glyma06g04540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTACCAACAGATCTTCTAAGGCCACGATCTTCATCCTGTTCTTCACGGTCTTGGCAGTGTCATCGGCGTTGGACCTGTCGATAATCTCGTATGACAGAAGCCACGCGGACAAGTCAGGGTGGAGGAGCGACGAGGAGCATGGCAAGGTGTATAATGCCATCGACGAGATGGAAGAGAGGTTTCAGATCGATCCAAAGAAAACCTTAAGTTTGTCGAGCAGCACAATGCTGGAAACCGGACATACAAGCAGAATGATGACCAGGCCAAGTAGCCGTTACGCTCCGCGCGTGAGTGACAACTTGTCGGAATCTGTTGATTGGAGGAAAGAAGGCGCTGTTGTCCGAGTCAAAACCCAATCAGAATGCGGATTAGAAAAAAAGAGAGCTGCAGGACATTCACAGTCATTGCCGCAGTGGAAGGAATTAACAAAGATATCAATGCAGGATGTAGTGGTGGACTTGCGGGACTATGCCTTAGAGTTCATTATCAACAATGGTGGCATTGACACCGAAGAGGATTACCCCTTTCAAGGTGCTGTTGGTATTTGTGATCAATATAAGATAAATGCAGTTGATGGTTACGAACGTCAAATCAACCATAAGTTTTTTAATCAACTTTACTTGAAAAACCATGGTGTTACAGCTGTTGGGTACGGAACAGAAAATGGAATTGATTATTGGATTGTTAAGAATTCATGGGGTGAGAATTGGGGTGAGGCAGGTTATGTAAGAATGGAACGTAATACAGCAGAAGACACTGCAGGAAAGTTGGCCAAAATCCCTCAAACCCTGATAACTCCAGCTAAACTCACTGGGACTTTACAGTTGTTTATTCGTGACATGGTAATTTATAATTTTAACCATGTGGTGGATAAGATAAAGTTGGGTATTTTAAGATTTAAATTAAAGTATAATCCTGTGGAGACTATTTTGATAAGTTTTTTTTATAAAAAAATATCTTATTTACAATCCTTAGAATTACCTATTTTTTTCTATTAA
Predicted protein sequences of Glyma06g04540
>Glyma06g04540.1   sequence type=predicted peptide   gene model=Glyma06g04540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGTNRSSKATIFILFFTVLAVSSALDLSIISYDRSHADKSGWRSDEEHGKVYNAIDEMEERFQIDPKKTLSLSSSTMLETGHTSRMMTRPSSRYAPRVSDNLSESVDWRKEGAVVRVKTQSECGLEKKRAAGHSQSLPQWKELTKISMQDVVVDLRDYALEFIINNGGIDTEEDYPFQGAVGICDQYKINAVDGYERQINHKFFNQLYLKNHGVTAVGYGTENGIDYWIVKNSWGENWGEAGYVRMERNTAEDTAGKLAKIPQTLITPAKLTGTLQLFIRDMVIYNFNHVVDKIKLGILRFKLKYNPVETILISFFYKKISYLQSLELPIFFY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo