SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g04353

Feature Type:gene_model
Chromosome:Gm06
Start:3015571
stop:3019304
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g04353
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G45249AT Annotation by Michelle Graham. TAIR10: abscisic acid responsive elements-binding factor 2 | chr1:17165420-17167415 REVERSE LENGTH=416 SoyBaseE_val: 1.00E-71ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0010255GO-bp Annotation by Michelle Graham. GO Biological Process: glucose mediated signaling pathway SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
PTHR22952Panther CAMP-RESPONSE ELEMENT BINDING PROTEIN-RELATED JGI ISS
PTHR22952:SF40Panther SUBFAMILY NOT NAMED JGI ISS
PF00170PFAM bZIP transcription factor JGI ISS
UniRef100_I1K801UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K801_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q00M78UniRef Annotation by Michelle Graham. Most informative UniRef hit: Bzip transcription factor n=1 Tax=Glycine max RepID=Q00M78_SOYBN SoyBaseE_val: 4.00E-163ISS

Expression Patterns of Glyma06g04353
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g04353 not represented in the dataset
Glyma06g04353 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g04353
ParalogEvidenceComments
Glyma04g04170 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g04353 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g040400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g04353
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g04353
>Glyma06g04353.1   sequence type=CDS   gene model=Glyma06g04353   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGTTTGGAAGGACATTTTCGAAGGAATACGGTGGCCTCGGTGGGCCCAACTTGGCGGCCCAGACGCAGAGGCAGCCAACGCTGAGAGAGATGACGTTGGAGGAGTTTTTGGTCAGAGCTGGTGTTGTTAGAGAAGATGTCAAACCGAACGACGGCGTTTTCGTAGATCTGTCTCGCGTTGGGAATAATAATAGTGATTTGGGATTGGGGTTTCAGCAGATGAACAAGGTTGCTGCTGCTGCTGCTACCGGTTTGATGGGTAACCGGTTGAACAATGATCCGCTTGTGGGTCTTCAGTCTTCTGCTAACTTGCCTTTGAATGTTAATGGGGTGGGAGCATCGAATCAGCAGCCACAGATGCAGAGTCCACAGCATCAGCATCAACAGCAGCATCAGCATCAGCAACTACATCAACAACAGCAGCAGCCGCAGATATTTCCTAAGCAGAGTACTATGACTTATGCAGCTGCTCAGATGCCTCAGGGAATGGTGAGGGGTGGGGTTGTGGGGCTTGGTGGTGGTGACCAGAGTTTGAGTGTGCAAGGTGGAGGGATTGGTGGTATGGTTGGTTTGGCACCTGGTTCTGTTCATGTAGCTACTGGCTCTCCTGCTGCTAACCAGCTGTCCTCCGGTGATAGGATTGGGAAGAGCAATGGTGATACCTCGTCCGTGTCCCCGGTTCCTTATGTCTTTAATGGTGGTCTGCGAGGGAGGAAGAGCGGGGGAGCTGTCGAGAAGGTGATTGAGAGGAGGCAGAGAAGGATGATAAAGAATAGAGAGTCAGCTGCCAGGTCGCGGGCTCGCAAACAGGCTTATACCATGGAATTAGAAGCAGAAGTTGCAAAGTTAAAAGAGGAGAACGAAGAACTTCAGAAAAAACAGGCAGAAATTATGGAAATTCAGAAAAATCAAGTTAAGGAAATGATGAATTTGCAACGAGAAGTGAAGAGAAGACGCCTAAGACGAACACAAACTGGTCCATGGTAG
Predicted protein sequences of Glyma06g04353
>Glyma06g04353.1   sequence type=predicted peptide   gene model=Glyma06g04353   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRFGRTFSKEYGGLGGPNLAAQTQRQPTLREMTLEEFLVRAGVVREDVKPNDGVFVDLSRVGNNNSDLGLGFQQMNKVAAAAATGLMGNRLNNDPLVGLQSSANLPLNVNGVGASNQQPQMQSPQHQHQQQHQHQQLHQQQQQPQIFPKQSTMTYAAAQMPQGMVRGGVVGLGGGDQSLSVQGGGIGGMVGLAPGSVHVATGSPAANQLSSGDRIGKSNGDTSSVSPVPYVFNGGLRGRKSGGAVEKVIERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELQKKQAEIMEIQKNQVKEMMNLQREVKRRRLRRTQTGPW*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo