Glyma06g04320 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g04320

Feature Type:	gene_model
Chromosome:	Gm06
Start:	2987978
stop:	2993077
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g04320

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G17650	AT	Annotation by Michelle Graham. TAIR10: Polyketide cyclase / dehydrase and lipid transport protein \| chr4:9827749-9829443 FORWARD LENGTH=256	SoyBase	E_val: 5.00E-90	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0015824	GO-bp	Annotation by Michelle Graham. GO Biological Process: proline transport	SoyBase	N/A	ISS
GO:0016036	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation	SoyBase	N/A	ISS
GO:0019243	GO-bp	Annotation by Michelle Graham. GO Biological Process: methylglyoxal catabolic process to D-lactate	SoyBase	N/A	ISS
GO:0019375	GO-bp	Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process	SoyBase	N/A	ISS
GO:0042631	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG3177	KOG	Oligoketide cyclase/lipid transport protein	JGI		ISS
PTHR12901	Panther	UNCHARACTERIZED	JGI		ISS
PF03364	PFAM	Polyketide cyclase / dehydrase and lipid transport	JGI		ISS
UniRef100_I1K7Z9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K7Z9_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q00M76	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Aromatic-rich family protein n=1 Tax=Glycine max RepID=Q00M76_SOYBN	SoyBase	E_val: 3.00E-165	ISS

Expression Patterns of Glyma06g04320

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g04320

Paralog	Evidence	Comments
Glyma04g04150	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g04320 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g040100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g04320

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g04320

Limit To All Plant Sequences

>Glyma06g04320.1   sequence type=CDS   gene model=Glyma06g04320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCGCCATTTTTGTCGACCTCGAAGGCCCTTTGCTCCTTAGCATCGCGCAAAAGCGGTGGTAGTCAATTGATTAGGTCTAGCAAGAGCAGTGGGAAGCACGATGGATGCAGATGCATCACTACAGCCATTACCGGCGGCCATCACAATCATCCTTCCGTCTCTCGCATCGGCTTTTCCTCTCTCATCGGAGGATCGTGCAATAGCAATAATCATTATTATAATTATAATGTTGTTCAATCAAGACGGTTTCTTGGATGTGGAGATGGTGAAGAAGGTATTCTATCCAGAACTTACGAGGAGAGGCGCGTTTTGGGGTACTCTACAGAGCAATTATTTGAAGTTGTTTCTGCTGTTGACTTCTATCATGGTTTTGTCCCATGGTGTCAAAGGTCGGACATACTTAGACACTATCCAGACGGATCATTTGATGCTGAGTTGGAGATTGGATTTAAATTCCTCGTTGAAAGTTATGTTTCTCATGTTGAATTGGACAAACCAAAGCGTATAAAGACAACTGTGTCGCAGAGTACCCTGTTTGAGCATTTGATAAACATATGGGAGTTTAACCCTGGCCCTGTTCCAGGAAGTTGCGATCTTTATTTCTTGGTGGATTTTAAGTTTCAGTCTCCACTTTACAGACAGATTGCATCGGTGTTCTTTAAGGAGGTAGCCTCTAGGATGGTTGGTTCATTTACTGAGCGTTGCCGTTTGATATATGGACCGGAAGTGCGGGTCCTTGAAAACTCGTATGGAAAAAGGGCATAA

Predicted protein sequences of Glyma06g04320

Limit To All Plant Sequences

>Glyma06g04320.1   sequence type=predicted peptide   gene model=Glyma06g04320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPPFLSTSKALCSLASRKSGGSQLIRSSKSSGKHDGCRCITTAITGGHHNHPSVSRIGFSSLIGGSCNSNNHYYNYNVVQSRRFLGCGDGEEGILSRTYEERRVLGYSTEQLFEVVSAVDFYHGFVPWCQRSDILRHYPDGSFDAELEIGFKFLVESYVSHVELDKPKRIKTTVSQSTLFEHLINIWEFNPGPVPGSCDLYFLVDFKFQSPLYRQIASVFFKEVASRMVGSFTERCRLIYGPEVRVLENSYGKRA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain