| 
 | 
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code | 
|---|---|---|---|---|---|
| AT2G20450 | AT | Annotation by Michelle Graham. TAIR10: Ribosomal protein L14 | chr2:8813923-8815071 FORWARD LENGTH=134 | SoyBase | E_val: 6.00E-16 | ISS | 
| GO:0001510 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA methylation | SoyBase | N/A | ISS | 
| GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS | 
| GO:0042254 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis | SoyBase | N/A | ISS | 
| GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS | 
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS | 
| GO:0005773 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuole | SoyBase | N/A | ISS | 
| GO:0005783 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum | SoyBase | N/A | ISS | 
| GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS | 
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS | 
| GO:0022625 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit | SoyBase | N/A | ISS | 
| GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS | 
| PTHR11127 | Panther | 60S RIBOSOMAL PROTEIN L14 | JGI | ISS | |
| PF01929 | PFAM | Ribosomal protein L14 | JGI | ISS | |
| UniRef100_B9SV21 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L14, putative n=1 Tax=Ricinus communis RepID=B9SV21_RICCO | SoyBase | E_val: 3.00E-14 | ISS | 
| UniRef100_C6SXV0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SXV0_SOYBN | SoyBase | E_val: 3.00E-16 | ISS | 
| Glyma06g04193 not represented in the dataset | Glyma06g04193 not represented in the dataset | 
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection | Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome | 
| Corresponding Name | Annotation Version | Evidence | Comments | 
|---|---|---|---|
| Glyma.06g038800 | Wm82.a2.v1 | IGC | As supplied by JGI | 
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 | 
>Glyma06g04193.1 sequence type=CDS gene model=Glyma06g04193 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCTCCTAAGAAGAAAGATCTTGTTAAAGCCATGGAGGATGTTAATGTTAAGAACAAGTGGAAGAAGAGTTCATAGGGGCAGAAAATTCATTTTCAGAAAGAGAAGGGCCTCCCTCAATGATTTTGATAGGTTCAAGATAATGTTGGCCAAGATCAAGAGGGGAGCGGTTGTAAGGCAAGAACTTGCTAAGCTGAAGAAGAGCGCTTAG
>Glyma06g04193.1 sequence type=predicted peptide gene model=Glyma06g04193 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLLRRKILLKPWRMLMLRTSGRRVHRGRKFIFRKRRASLNDFDRFKIMLAKIKRGAVVRQELAKLKKSA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||