Report for Sequence Feature Glyma06g04065
Feature Type: gene_model
Chromosome: Gm06
Start: 2834133
stop: 2843722
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g04065
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G26540 AT
Annotation by Michelle Graham. TAIR10: uroporphyrinogen-III synthase family protein | chr2:11287666-11290224 REVERSE LENGTH=321
SoyBase E_val: 3.00E-116 ISS
GO:0006779 GO-bp
Annotation by Michelle Graham. GO Biological Process: porphyrin-containing compound biosynthetic process
SoyBase N/A ISS
GO:0006780 GO-bp
Annotation by Michelle Graham. GO Biological Process: uroporphyrinogen III biosynthetic process
SoyBase N/A ISS
GO:0033014 GO-bp
Annotation by Michelle Graham. GO Biological Process: tetrapyrrole biosynthetic process
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0004852 GO-mf
Annotation by Michelle Graham. GO Molecular Function: uroporphyrinogen-III synthase activity
SoyBase N/A ISS
PF02602 PFAM
Uroporphyrinogen-III synthase HemD
JGI ISS
UniRef100_G7J5U1 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Uroporphyrinogen-III synthase n=1 Tax=Medicago truncatula RepID=G7J5U1_MEDTR
SoyBase E_val: 5.00E-154 ISS
UniRef100_I1K7X5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K7X5_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma06g04065
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma06g04065
Paralog Evidence Comments
Glyma04g03940 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g04065 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g037300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g04065
Coding sequences of Glyma06g04065
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g04065.1 sequence type=CDS gene model=Glyma06g04065 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCCCATTTTTCTCTCTCCCCTCTCTCCTGTGCACCTTCTCCTCTACCACCACGCCGCCGAATCTTTCTCTCTCCTCCTCGAGCCGCCGCATCTTCCGCCACCGACGTCGTTTCCACTTCCACTTCCACTTCATCTTCTGCTTCGAATTTCGCGCCCAAAGTCGTTGTCACCAGAGAGCGCGGCAAGAACGCCAAGCTTATCGCTGCTCTGGCTAAACATGAAATCAATTGTTTGGAGCTTCCACTCATTGAGCACATGCAAGGACCTGATTTAGATAGGCTTCCTTCTGTATTAGGTGACAATGCATTTGATTGGGTTGTGATAACGTCTCCTGAGGCAGGCTCAGTCTTTCTAGAGGCATGGAGAGCTTCTGGGATGCCTCATGTCAAAATAGGTGTTGTTGGGGCTGGCACTGCAAGCATTTTCAAGGAAGCTTTGCAGTCTTCCAACCGATCCCTTGATATTGCCTTTGTGCCATCAAAAGCAACAGGAAAGGTTTTGGCTACTGAGCTTCCTAAGATTGGAAGTAAATGCACGGTTCTCTATCCTGCTTCTGCAAAGGCTAGTAATGAGATTGAGGAAGGACTTTCAAATCGTGGATTTGAGGTTACTAGGATGAATACATATACAACGGTGCCAGTTCAACATGTTGACCATACGGTTCTAAAGATAGCACTTGCTGCCCCTGTTGTTACAGTAGCTTCACCATCTTCTATTCGGGCCTGGAAGAATCTTCTTTCAGATTCAGAGTGGAACAATTCTGTTGCGTGCATTGGTGAGACAACTGCTACAATGGCAAGAAGTTTAGGTTTCACAAATGTGTACTTCCCAACACAACCAGGCATCGAAGGCTGGGTCGAGAGCATTCTTGAAGCATTAGGGTTCCTATGA
Predicted protein sequences of Glyma06g04065
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g04065.1 sequence type=predicted peptide gene model=Glyma06g04065 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAHFSLSPLSCAPSPLPPRRRIFLSPPRAAASSATDVVSTSTSTSSSASNFAPKVVVTRERGKNAKLIAALAKHEINCLELPLIEHMQGPDLDRLPSVLGDNAFDWVVITSPEAGSVFLEAWRASGMPHVKIGVVGAGTASIFKEALQSSNRSLDIAFVPSKATGKVLATELPKIGSKCTVLYPASAKASNEIEEGLSNRGFEVTRMNTYTTVPVQHVDHTVLKIALAAPVVTVASPSSIRAWKNLLSDSEWNNSVACIGETTATMARSLGFTNVYFPTQPGIEGWVESILEALGFL*