SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g04065): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g04065): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g04065

Feature Type:gene_model
Chromosome:Gm06
Start:2834133
stop:2843722
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G26540AT Annotation by Michelle Graham. TAIR10: uroporphyrinogen-III synthase family protein | chr2:11287666-11290224 REVERSE LENGTH=321 SoyBaseE_val: 3.00E-116ISS
GO:0006779GO-bp Annotation by Michelle Graham. GO Biological Process: porphyrin-containing compound biosynthetic process SoyBaseN/AISS
GO:0006780GO-bp Annotation by Michelle Graham. GO Biological Process: uroporphyrinogen III biosynthetic process SoyBaseN/AISS
GO:0033014GO-bp Annotation by Michelle Graham. GO Biological Process: tetrapyrrole biosynthetic process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0004852GO-mf Annotation by Michelle Graham. GO Molecular Function: uroporphyrinogen-III synthase activity SoyBaseN/AISS
PF02602PFAM Uroporphyrinogen-III synthase HemD JGI ISS
UniRef100_G7J5U1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Uroporphyrinogen-III synthase n=1 Tax=Medicago truncatula RepID=G7J5U1_MEDTR SoyBaseE_val: 5.00E-154ISS
UniRef100_I1K7X5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K7X5_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g04065 not represented in the dataset

Glyma06g04065 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g03940 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g037300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g04065.1   sequence type=CDS   gene model=Glyma06g04065   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCCATTTTTCTCTCTCCCCTCTCTCCTGTGCACCTTCTCCTCTACCACCACGCCGCCGAATCTTTCTCTCTCCTCCTCGAGCCGCCGCATCTTCCGCCACCGACGTCGTTTCCACTTCCACTTCCACTTCATCTTCTGCTTCGAATTTCGCGCCCAAAGTCGTTGTCACCAGAGAGCGCGGCAAGAACGCCAAGCTTATCGCTGCTCTGGCTAAACATGAAATCAATTGTTTGGAGCTTCCACTCATTGAGCACATGCAAGGACCTGATTTAGATAGGCTTCCTTCTGTATTAGGTGACAATGCATTTGATTGGGTTGTGATAACGTCTCCTGAGGCAGGCTCAGTCTTTCTAGAGGCATGGAGAGCTTCTGGGATGCCTCATGTCAAAATAGGTGTTGTTGGGGCTGGCACTGCAAGCATTTTCAAGGAAGCTTTGCAGTCTTCCAACCGATCCCTTGATATTGCCTTTGTGCCATCAAAAGCAACAGGAAAGGTTTTGGCTACTGAGCTTCCTAAGATTGGAAGTAAATGCACGGTTCTCTATCCTGCTTCTGCAAAGGCTAGTAATGAGATTGAGGAAGGACTTTCAAATCGTGGATTTGAGGTTACTAGGATGAATACATATACAACGGTGCCAGTTCAACATGTTGACCATACGGTTCTAAAGATAGCACTTGCTGCCCCTGTTGTTACAGTAGCTTCACCATCTTCTATTCGGGCCTGGAAGAATCTTCTTTCAGATTCAGAGTGGAACAATTCTGTTGCGTGCATTGGTGAGACAACTGCTACAATGGCAAGAAGTTTAGGTTTCACAAATGTGTACTTCCCAACACAACCAGGCATCGAAGGCTGGGTCGAGAGCATTCTTGAAGCATTAGGGTTCCTATGA

>Glyma06g04065.1   sequence type=predicted peptide   gene model=Glyma06g04065   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAHFSLSPLSCAPSPLPPRRRIFLSPPRAAASSATDVVSTSTSTSSSASNFAPKVVVTRERGKNAKLIAALAKHEINCLELPLIEHMQGPDLDRLPSVLGDNAFDWVVITSPEAGSVFLEAWRASGMPHVKIGVVGAGTASIFKEALQSSNRSLDIAFVPSKATGKVLATELPKIGSKCTVLYPASAKASNEIEEGLSNRGFEVTRMNTYTTVPVQHVDHTVLKIALAAPVVTVASPSSIRAWKNLLSDSEWNNSVACIGETTATMARSLGFTNVYFPTQPGIEGWVESILEALGFL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo