Glyma06g04000 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g04000

Feature Type:	gene_model
Chromosome:	Gm06
Start:	2788255
stop:	2789523
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g04000

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G15770	AT	Annotation by Michelle Graham. TAIR10: Cupredoxin superfamily protein \| chr2:6871257-6872245 REVERSE LENGTH=301	SoyBase	E_val: 2.00E-25	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
PF02298	PFAM	Plastocyanin-like domain	JGI		ISS
UniRef100_B6TG98	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Copper ion binding protein n=1 Tax=Zea mays RepID=B6TG98_MAIZE	SoyBase	E_val: 7.00E-23	ISS
UniRef100_I1K7W9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K7W9_SOYBN	SoyBase	E_val: 3.00E-101	ISS

Expression Patterns of Glyma06g04000

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g04000

Paralog	Evidence	Comments
Glyma04g03900	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g04000 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g036700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g04000

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g04000

Limit To All Plant Sequences

>Glyma06g04000.1   sequence type=CDS   gene model=Glyma06g04000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGCCACTAGAATTTTGGCACAAGGAGTATTTGTGTTCCTTGTTATTACGTGTGTGGGAGCCGAGAGCGAGCCCAGAACCATTTTGGTTGGAGACTCTCAAGGTTGGCAAGCCGGCACTAACTACACCCAATGGGCCATCCAAAATAGCCCCTTCCACATCAATGACACACTTCTGTTCAAGTATCCAGGGAATTCCACGACGCTGGCTCAGAGTGTGTACTTACTACCAAACCAGTGGAGCTACATAACGTGCGAATTCAGAGGGGCAAAGCTGTTGGGTAACGCAACTGAGGGTGATGGCGAGGGCTTTAAGGTTGAACTTAATCAGTTGAAACCTTATTACTTTGCCTCTGCGGAAGGCAACTTTTATGACTGCATTGCTGGCCTTTCAAAGTTCATTGCTGTGCCATCAACAAGCTCTGGCTGA

Predicted protein sequences of Glyma06g04000

Limit To All Plant Sequences

>Glyma06g04000.1   sequence type=predicted peptide   gene model=Glyma06g04000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDATRILAQGVFVFLVITCVGAESEPRTILVGDSQGWQAGTNYTQWAIQNSPFHINDTLLFKYPGNSTTLAQSVYLLPNQWSYITCEFRGAKLLGNATEGDGEGFKVELNQLKPYYFASAEGNFYDCIAGLSKFIAVPSTSSG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain