SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g03920

Feature Type:gene_model
Chromosome:Gm06
Start:2731886
stop:2732801
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g03920
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G26500AT Annotation by Michelle Graham. TAIR10: cytochrome b6f complex subunit (petM), putative | chr2:11270370-11270747 FORWARD LENGTH=125 SoyBaseE_val: 9.00E-35ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009512GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytochrome b6f complex SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009496GO-mf Annotation by Michelle Graham. GO Molecular Function: plastoquinol--plastocyanin reductase activity SoyBaseN/AISS
PF08041PFAM PetM family of cytochrome b6f complex subunit 7 JGI ISS
UniRef100_B9R7K1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Plastoquinol-plastocyanin reductase, putative n=1 Tax=Ricinus communis RepID=B9R7K1_RICCO SoyBaseE_val: 2.00E-42ISS
UniRef100_C6T1C6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T1C6_SOYBN SoyBaseE_val: 3.00E-78ISS

Expression Patterns of Glyma06g03920
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g03920
ParalogEvidenceComments
Glyma04g03820 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g03920 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g035900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g03920
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g03920
>Glyma06g03920.1   sequence type=CDS   gene model=Glyma06g03920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTATGGCCACAGCTGTCGTGTGTCCTCAGAACATCACCGGAGCCATCGTGGGCTCACCCAAGAAGAGAGTGGTGCACGTGAGAGGGTTAAATTCATTTGGGGGACTGAAGGCTAGCAATGGTGTTGTCTCTTTGGGACTTCCTATGAGCACTGAGAAGTGCTTTGCTAAGGTTGTGAGTTCAGTGAAAGCAGCAACATCAAATGGAAAAGGAAAGGGTGGAGGGGCACTCTCCTCCACGTGCAACGCCGCAGGTGAGATATTCACGATTGCTGCTATCATCAATGGACTTGTTCTTGTCGGGGTCGCAGTTGGGTTTGTGCTCCTGCGAGTTGAAGCATGGGTCGAGGAGTCCGAGGCAGAATGA
Predicted protein sequences of Glyma06g03920
>Glyma06g03920.1   sequence type=predicted peptide   gene model=Glyma06g03920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAMATAVVCPQNITGAIVGSPKKRVVHVRGLNSFGGLKASNGVVSLGLPMSTEKCFAKVVSSVKAATSNGKGKGGGALSSTCNAAGEIFTIAAIINGLVLVGVAVGFVLLRVEAWVEESEAE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo