SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g03770

Feature Type:gene_model
Chromosome:Gm06
Start:2660512
stop:2662383
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g03770
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G19300AT Annotation by Michelle Graham. TAIR10: Nucleotide-diphospho-sugar transferases superfamily protein | chr1:6671451-6672506 REVERSE LENGTH=351 SoyBaseE_val: 6.00E-177ISS
GO:0006569GO-bp Annotation by Michelle Graham. GO Biological Process: tryptophan catabolic process SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009684GO-bp Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010051GO-bp Annotation by Michelle Graham. GO Biological Process: xylem and phloem pattern formation SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0010417GO-bp Annotation by Michelle Graham. GO Biological Process: glucuronoxylan biosynthetic process SoyBaseN/AISS
GO:0016051GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate biosynthetic process SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0032504GO-bp Annotation by Michelle Graham. GO Biological Process: multicellular organism reproduction SoyBaseN/AISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:0052386GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall thickening SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0016757GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups SoyBaseN/AISS
GO:0016758GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring hexosyl groups SoyBaseN/AISS
GO:0047262GO-mf Annotation by Michelle Graham. GO Molecular Function: polygalacturonate 4-alpha-galacturonosyltransferase activity SoyBaseN/AISS
PTHR13778Panther GLYCOSYL TRANSFERASE-RELATED JGI ISS
PF01501PFAM Glycosyl transferase family 8 JGI ISS
UniRef100_D0ECQ6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glycosyltransferase family GT8 protein n=1 Tax=Populus deltoides RepID=D0ECQ6_POPDE SoyBaseE_val: 0ISS
UniRef100_I1K7U4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K7U4_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma06g03770
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g03770
ParalogEvidenceComments
Glyma04g03690 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g03770 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g034600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g03770
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g03770
>Glyma06g03770.1   sequence type=CDS   gene model=Glyma06g03770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAATTCAAGTCAAGAAGACCACAACCACGAGCACTAGTAGCATTCTTTCTCATTCTGTCCATCTTCTCACTACCGGCTTCATCATCATCATCTTCTTCTTCTTCCATTGATGACGTGAAATCAAGCACCATCATTCATCAATTCAAGGAAGCCCCCGAATTCTACAACTCCCCAGAATGCGCCTCCCTCACCGACAACGAGGAAGACAGTAGCGACAGGTACATATGTTCGGAGGAAGCGGTACACGTGGCAATGACGCTGGACACTACATACATCCGAGGATCCATGGCGGCGATCCTCTCGGTCCTCCAACACTCCTCGTGCCCGCAGAACACATTCTTCCACTTCGTCTGCTCCTCGAGCGCGTCCCTCCTACGCGCCGCGATCTCCCACTCGTTCCCTTACCTGAACTTCCAGCTATACACCTTCGACGACTCCCAGGTCTCGGGACTCATCTCAAGCTCAATCCGCTCCGCACTGGATTGCCCCTTAAACTACGCGCGCTCCTACTTGGCCAACCTCTTGCCCATCTGCGTGAGGCGCGTGGTGTACTTGGACTCCGATCTCATCCTCGTCGACGACATTGCCAAGCTGGCAGCAACACCATTGGGCGAAAACAAGGTCCTGGCTGCCCCCGAATACTGCAACGCCAATTTCACCTCGTACTTCACCCCAACGTTCTGGTCCAACCCTTCGCTGTCTCTCACGTTCGCGGATAGGAGGCCGTGCTACTTCAACACGGGGGTCATGGTCATCGATTTGGAGCGGTGGCGGGAGGGGGATTACACGACAAAAATTGAAGAGTGGATGGAGCTGCAGAAGAGGATGAGGATCTATGACTTGGGTTCCTTGCCGCCGTTTTTGCTTGTCTTTGCTGGGAACATTGCTTCCGTTGATCATAGGTGGAACCAGCACGGCCTCGGTGGGGACAACTTTCGTGGGCTTTGCAGAGATCTGCACCCTGGTCCTGTTAGTCTCTTGCATTGGAGTGGGAAAGGTAAACCGTGGGTTCGATTGGACGCTAATAGGCCTTGTCCTTTGGATGCGCTTTGGGCACCTTATGATCTATTGAACACTCCCTTTTCTTTGGATTCTTGA
Predicted protein sequences of Glyma06g03770
>Glyma06g03770.1   sequence type=predicted peptide   gene model=Glyma06g03770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKFKSRRPQPRALVAFFLILSIFSLPASSSSSSSSSIDDVKSSTIIHQFKEAPEFYNSPECASLTDNEEDSSDRYICSEEAVHVAMTLDTTYIRGSMAAILSVLQHSSCPQNTFFHFVCSSSASLLRAAISHSFPYLNFQLYTFDDSQVSGLISSSIRSALDCPLNYARSYLANLLPICVRRVVYLDSDLILVDDIAKLAATPLGENKVLAAPEYCNANFTSYFTPTFWSNPSLSLTFADRRPCYFNTGVMVIDLERWREGDYTTKIEEWMELQKRMRIYDLGSLPPFLLVFAGNIASVDHRWNQHGLGGDNFRGLCRDLHPGPVSLLHWSGKGKPWVRLDANRPCPLDALWAPYDLLNTPFSLDS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo