Report for Sequence Feature Glyma06g03720
Feature Type: gene_model
Chromosome: Gm06
Start: 2615731
stop: 2620930
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g03720
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G19330 AT
Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G75060.1); Has 145 Blast hits to 145 proteins in 43 species: Archae - 0; Bacteria - 0; Metazoa - 40; Fungi - 0; Plants - 104; Viruses - 0; Other Eukaryotes - 1 (source: NCBI BLink). | chr1:6680824-6683290 REVERSE LENGTH=
SoyBase E_val: 2.00E-112 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PTHR13286 Panther
SAP30
JGI ISS
PTHR13286:SF4 Panther
SUBFAMILY NOT NAMED
JGI ISS
UniRef100_I1K7U1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K7U1_SOYBN
SoyBase E_val: 3.00E-163 ISS
UniRef100_Q9LN65 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: F18O14.5 n=1 Tax=Arabidopsis thaliana RepID=Q9LN65_ARATH
SoyBase E_val: 9.00E-110 ISS
Expression Patterns of Glyma06g03720
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma06g03720
Paralog Evidence Comments
Glyma04g03630 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g03720 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g034200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g03720
Coding sequences of Glyma06g03720
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g03720.1 sequence type=CDS gene model=Glyma06g03720 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCTTGAGGCAATGGAAAGTTCGGTCAATGGTGGGTTTACCCATTTGCAGAGCTGTGGAGATAGCAGCGAAGAAGAGTTATCGGTGCTTCCTCGTCACACCAAAGTGGTCGTAACAGGAAATAACCGCACCAAATCGGTGCTCGTTGGTCTTCAAGGTGTTGTTAAGAAAGCCGTTGGACTAGGTGGATGGCATTGGCTGGTTCTTACAAATGGTATTGAAGTGAAGCTACAAAGGAATGCTCTTAGCGTGATTGAAGCACCCACCGGTAACGAGGAAGATGATGACCTTGAGTTTGAAAATATGCCGTGGAATGGATCAGATTTGGCATCGGACGATACACAGAAGTTCCACAAGCCGAGGCATAGAATGCATAGAACATTGGGATCATCTCACAAGACCATGAGTAGGTCATTCTCTGGCGATTCACAGTCAAAGGGCTCCGTTTCTATGCCTCATGGGTCCACGAAGGTAGACTTGAGCAAACTTGAAATGGCTGCATTGTGGAGATATTGGCGACATTTTAATCTAGTGGATGCGGTCCCAAACCCATCAAAAGAGCAGCTAGTAGATGTTGTTCAGAGGCATTTCATGTCGCAGCAAATGGACGAATTGCAGGTGATTGTGGGATTCGTCCAAGCTGCAAAGAGGCTTAAGACTGTGTGCAAATGA
Predicted protein sequences of Glyma06g03720
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g03720.1 sequence type=predicted peptide gene model=Glyma06g03720 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MLEAMESSVNGGFTHLQSCGDSSEEELSVLPRHTKVVVTGNNRTKSVLVGLQGVVKKAVGLGGWHWLVLTNGIEVKLQRNALSVIEAPTGNEEDDDLEFENMPWNGSDLASDDTQKFHKPRHRMHRTLGSSHKTMSRSFSGDSQSKGSVSMPHGSTKVDLSKLEMAALWRYWRHFNLVDAVPNPSKEQLVDVVQRHFMSQQMDELQVIVGFVQAAKRLKTVCK*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
