SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g03640

Feature Type:gene_model
Chromosome:Gm06
Start:2552793
stop:2554972
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g03640
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G31200AT Annotation by Michelle Graham. TAIR10: actin depolymerizing factor 6 | chr2:13294171-13294948 FORWARD LENGTH=146 SoyBaseE_val: 7.00E-81ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003779GO-mf Annotation by Michelle Graham. GO Molecular Function: actin binding SoyBaseN/AISS
KOG1735 KOG Actin depolymerizing factor JGI ISS
PTHR11913Panther ACTIN DEPOLYMERIZING FACTOR JGI ISS
PF00241PFAM Cofilin/tropomyosin-type actin-binding protein JGI ISS
UniRef100_A1XJ47UniRef Annotation by Michelle Graham. Most informative UniRef hit: Actin depolymerizing factor 4 n=1 Tax=Gossypium hirsutum RepID=A1XJ47_GOSHI SoyBaseE_val: 4.00E-87ISS
UniRef100_I1K7T2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K7T2_SOYBN SoyBaseE_val: 2.00E-101ISS

Expression Patterns of Glyma06g03640
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g03640 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g033400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g03640
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g03640
>Glyma06g03640.1   sequence type=CDS   gene model=Glyma06g03640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGCATTTGGAAATGCCTCTTCTGGCATTGGTGTTGCTGAGCATAGCGTAAACACGTTCCTGGAATTGCAGAGGAAGAAAGTTCATCGCTATGTGATTTTTAAAATTGATGAGAAAAAGAAAGAGGTTATCGTTGAAAAAACTGGAGGCCCTGCTGAGAGCTATGATGATTTCACTGCATCCTTGCCTGAAAATGATTGCCGATACGCTGTCTTTGACTTTGATTTTGTGACATCTGAGAACTGCCAAAAGAGCAAAATCTTTTTTATTGCATGGTCTCCTTCAGTGGCCCGCATTCGCCCAAAGATGCTATATGCAACATCCAAGGACAGGTTCAGAAGGGAGCTGCAGGGCATCCATTATGAGATTCAGGCAACAGACCCAACAGAGATGGATCTTGAAGTCCTCAGAGAACGTGCAAACTGA
Predicted protein sequences of Glyma06g03640
>Glyma06g03640.1   sequence type=predicted peptide   gene model=Glyma06g03640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEAFGNASSGIGVAEHSVNTFLELQRKKVHRYVIFKIDEKKKEVIVEKTGGPAESYDDFTASLPENDCRYAVFDFDFVTSENCQKSKIFFIAWSPSVARIRPKMLYATSKDRFRRELQGIHYEIQATDPTEMDLEVLRERAN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo