Glyma06g03576 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g03576

Feature Type:	gene_model
Chromosome:	Gm06
Start:	2503688
stop:	2505224
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g03576

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G36660	AT	Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF1195) \| chr4:17285953-17287281 REVERSE LENGTH=179	SoyBase	E_val: 3.00E-27	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF06708	PFAM	Protein of unknown function (DUF1195)	JGI		ISS
UniRef100_I1JTC2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JTC2_SOYBN	SoyBase	E_val: 4.00E-58	ISS
UniRef100_Q9FYX2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: BAC19.4 n=1 Tax=Solanum lycopersicum RepID=Q9FYX2_SOLLC	SoyBase	E_val: 3.00E-27	ISS

Expression Patterns of Glyma06g03576

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g03576 not represented in the dataset	Glyma06g03576 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g03576

Paralog	Evidence	Comments
Glyma04g03510	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g03576 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g032700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g03576

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g03576

Limit To All Plant Sequences

>Glyma06g03576.1   sequence type=CDS   gene model=Glyma06g03576   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGATGGTGGCAAGTGGGTCCTCCAATAGCATTAGTAGGCACTTCTTGTTATGGGTCTTAGCTGCGGTTATTCTCATTGCTCTTTGGTCCATGCTCGCTGGCTCCGTCACCCTCAAATGGTCCTCGAGCAACAACGATGACTTCGATTCTACCATTCATGATGTGGGAGAGAGAGAGAAGGTGGTGAGGCACATGTGGGATGCGTACAGCCGCACTCACACGAAGTCCGTTGGATTACCCAAGTTTTGGTGGGAAGCTTTTGAAGCTGCTTACGAGCAATTGATGAGTGATGTTCCTGCCGTTTCAGAAATTGCCAAGATGTCTCTGCGGTCTCTTCCTCTTCAAATTCAATCACACTCGGTATAA

Predicted protein sequences of Glyma06g03576

Limit To All Plant Sequences

>Glyma06g03576.1   sequence type=predicted peptide   gene model=Glyma06g03576   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKMVASGSSNSISRHFLLWVLAAVILIALWSMLAGSVTLKWSSSNNDDFDSTIHDVGEREKVVRHMWDAYSRTHTKSVGLPKFWWEAFEAAYEQLMSDVPAVSEIAKMSLRSLPLQIQSHSV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain