Report for Sequence Feature Glyma06g03540
Feature Type: gene_model
Chromosome: Gm06
Start: 2472540
stop: 2474066
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g03540
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_I1K7S2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K7S2_SOYBN
SoyBase E_val: 2.00E-76 ISS
Expression Patterns of Glyma06g03540
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma06g03540
Paralog Evidence Comments
Glyma04g03470 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g03540 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g032300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g03540
Coding sequences of Glyma06g03540
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g03540.1 sequence type=CDS gene model=Glyma06g03540 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGGGAAAAAGAATCGCCAAAAAACGAAGGAACTTTCGGTAGCGATAGCTGAGGCTTCATCCAAAGGAGGTGACACTGAAGAACAACAACAACAACAACAACCTCAGCCTCCTCGAAAAAGAGGGAGACCTCGTAAGGTTGTTGTTGTGGAAACGGAAAGCGAAGTGAAAAAAGTGGAACCAAAAGAGGAACCAGAAGCTTCTACTTCTTCAGCAACGAAGAAAGAAGAACAACATAGGAGGCAACAAGTGGAGTTAACATCAGAATCGGTGGCATGCAAAAGAATCACAAAGGAAGAGATTCAAGTCCCAAAAGGGGAACCCTCGAGAAGCAGGGCGAGGAGGAAAAGCAAACCCAGAAAAAGCACTTAA
Predicted protein sequences of Glyma06g03540
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g03540.1 sequence type=predicted peptide gene model=Glyma06g03540 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MGKKNRQKTKELSVAIAEASSKGGDTEEQQQQQQPQPPRKRGRPRKVVVVETESEVKKVEPKEEPEASTSSATKKEEQHRRQQVELTSESVACKRITKEEIQVPKGEPSRSRARRKSKPRKST*