Report for Sequence Feature Glyma06g03520
Feature Type: gene_model
Chromosome: Gm06
Start: 2458447
stop: 2460956
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g03520
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G42760 AT
Annotation by Michelle Graham. TAIR10: Leucine carboxyl methyltransferase | chr5:17148953-17150105 FORWARD LENGTH=348
SoyBase E_val: 6.00E-164 ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0008168 GO-mf
Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity
SoyBase N/A ISS
PF04072 PFAM
Leucine carboxyl methyltransferase
JGI ISS
UniRef100_F4K327 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Leucine carboxyl methyltransferase n=3 Tax=Arabidopsis thaliana RepID=F4K327_ARATH
SoyBase E_val: 3.00E-161 ISS
UniRef100_I1K7S0 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K7S0_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma06g03520
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma06g03520
Paralog Evidence Comments
Glyma04g03430 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g03520 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g032100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g03520
Coding sequences of Glyma06g03520
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g03520.1 sequence type=CDS gene model=Glyma06g03520 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCAGATAAAGAAGTAGTAGTAAATGGGTTGTCTGAGGACCAAGCAGGGCAAGAACTGAAGCTTCCAGACTTGTTGAACAGTGATGCTGTTAGAGAAATCCATGCTAATATCGAAAAAGAATGGGATTTTCTTCAAAGGTCAGCTTGCCAAACCGCTGCGGGAAGGGCTCTGTGGAAGCATGCCATCCATGATCCACTGGCTGACTTGCTGGCAGGGGAGACTTACTTGAGAAACCTCCATGAAAAGATCAAGAAAGACATTCTCAACAATGCTCGCGAAACTTCCGGAGTCATTCTTGCCGTTCGAACCCTTTGGTTTGATTCTAGACTAGAAGATGCCCTTAATTCCACTAATGGCAAAGAAGCACAGGTTGTTCTCCTTGGTGCAGGAATGGACACGAGGGCATATCGTTTGAGTTGCTTGAAGGACAGCGATGTCTTTGAGGTTGACTTTCCACAAGTCTTGGATGTAAAAACCACTATTTTACAAGCGGCTAAGGACTCCTCATACGACTCCCAGCATATTATGTCCAAAGCCAAATCCTTAACCAGAGTAGCAGCTGACATAAGAGAAAGTGACTGGTTGGAAAAGCTAGAGATTGCAGGGTACTTGCCTGAGAAGAGCACTGTTTGGATTCTAGAAGGCATTCTCTACTACCTCACTCAATCCCATGCCATGCAAGTGCTAAGGATTTTAGCTAACAAATGCGCCCTAATCCACACAGTCCTCTTAGCAGACTTCATGAATAAGCCATCAACCACGCTATCCAATTCAGCATTCCAATTTTACAGCGATTGGCCAGACCAACTCTTGCCATCCATTGGCTTCACTCATGTAAAACTTTCACAAATTGGAGACCCAGATGCACATTTTGGTCTCTTGAATGATCCGTTAAATCTCTTCAACAAGCTCCGAAGCTTGCCTAGATCGTTACAAACCAATCCAGATGATGGAGCACCATGCTGTCGATTGTACTTGGTGGAAGCTTCTGGTTCACCTGATCAAAATGCTTCACATAACGGGCCAATCACTCAGACCTGA
Predicted protein sequences of Glyma06g03520
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g03520.1 sequence type=predicted peptide gene model=Glyma06g03520 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSDKEVVVNGLSEDQAGQELKLPDLLNSDAVREIHANIEKEWDFLQRSACQTAAGRALWKHAIHDPLADLLAGETYLRNLHEKIKKDILNNARETSGVILAVRTLWFDSRLEDALNSTNGKEAQVVLLGAGMDTRAYRLSCLKDSDVFEVDFPQVLDVKTTILQAAKDSSYDSQHIMSKAKSLTRVAADIRESDWLEKLEIAGYLPEKSTVWILEGILYYLTQSHAMQVLRILANKCALIHTVLLADFMNKPSTTLSNSAFQFYSDWPDQLLPSIGFTHVKLSQIGDPDAHFGLLNDPLNLFNKLRSLPRSLQTNPDDGAPCCRLYLVEASGSPDQNASHNGPITQT*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
