SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma06g03420

Feature Type:gene_model
Chromosome:Gm06
Start:2403107
stop:2404544
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G19530AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: N-terminal protein myristoylation, anaerobic respiration; LOCATED IN: cellular_component unknown; EXPRESSED IN: leaf apex, inflorescence meristem, hypocotyl, root, flower; EXPRESSED DURING: petal differentiation and expansion stage; Has 47 Blast hits to 47 proteins in 13 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 47; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:6763976-6764686 FORWA SoyBaseE_val: 1.00E-20ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0009061GO-bp Annotation by Michelle Graham. GO Biological Process: anaerobic respiration SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_B4YYB7UniRef Annotation by Michelle Graham. Most informative UniRef hit: ST225 n=1 Tax=Eutrema halophilum RepID=B4YYB7_THEHA SoyBaseE_val: 2.00E-20ISS
UniRef100_I1K7R0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K7R0_SOYBN SoyBaseE_val: 2.00E-100ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g03330 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g031000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g03420.1   sequence type=CDS   gene model=Glyma06g03420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTCTCTTATGGCAGGATGGGACTCTCTGATCTTAGATCCTGAATCAGCTACAATTGAGAGGAATCGATCACTCACCAAAGAAGAAATTGATGCTTACTGGCGAGCAAAGAAGGAGACAGAGTTAGAACACCTCAGAGCTATTTCCAAACTATCTGAGACTATTCAGACCCGAAAATGCGAGGATTCAGAGAATTCTCATAAGTCAAGTACTGTGACTTTGGCCAGCATAAAGGAGTCCTTAGGCATGGACGTTGACCAGAAAAGTTTAGAGCAGCTTATCAAGAAAAATGGCTGGTGGACCAAGAGCAACTGGGCATTTCTGAATGAACCGCCGGTGATAGAAGCTGCTTCCAACGAGTATGCGTCACAGTTTCACGTGGCCAACTTGGGGTCAACGAAATTTAACCCCGGAGATGGAATTAGTGCTTGA

>Glyma06g03420.1   sequence type=predicted peptide   gene model=Glyma06g03420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSLMAGWDSLILDPESATIERNRSLTKEEIDAYWRAKKETELEHLRAISKLSETIQTRKCEDSENSHKSSTVTLASIKESLGMDVDQKSLEQLIKKNGWWTKSNWAFLNEPPVIEAASNEYASQFHVANLGSTKFNPGDGISA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo