Report for Sequence Feature Glyma06g03420
Feature Type: gene_model
Chromosome: Gm06
Start: 2403107
stop: 2404544
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g03420
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G19530 AT
Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: N-terminal protein myristoylation, anaerobic respiration; LOCATED IN: cellular_component unknown; EXPRESSED IN: leaf apex, inflorescence meristem, hypocotyl, root, flower; EXPRESSED DURING: petal differentiation and expansion stage; Has 47 Blast hits to 47 proteins in 13 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 47; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:6763976-6764686 FORWA
SoyBase E_val: 1.00E-20 ISS
GO:0006499 GO-bp
Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation
SoyBase N/A ISS
GO:0009061 GO-bp
Annotation by Michelle Graham. GO Biological Process: anaerobic respiration
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_B4YYB7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: ST225 n=1 Tax=Eutrema halophilum RepID=B4YYB7_THEHA
SoyBase E_val: 2.00E-20 ISS
UniRef100_I1K7R0 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K7R0_SOYBN
SoyBase E_val: 2.00E-100 ISS
Expression Patterns of Glyma06g03420
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma06g03420
Paralog Evidence Comments
Glyma04g03330 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g03420 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g031000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g03420
Coding sequences of Glyma06g03420
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g03420.1 sequence type=CDS gene model=Glyma06g03420 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGGTTCTCTTATGGCAGGATGGGACTCTCTGATCTTAGATCCTGAATCAGCTACAATTGAGAGGAATCGATCACTCACCAAAGAAGAAATTGATGCTTACTGGCGAGCAAAGAAGGAGACAGAGTTAGAACACCTCAGAGCTATTTCCAAACTATCTGAGACTATTCAGACCCGAAAATGCGAGGATTCAGAGAATTCTCATAAGTCAAGTACTGTGACTTTGGCCAGCATAAAGGAGTCCTTAGGCATGGACGTTGACCAGAAAAGTTTAGAGCAGCTTATCAAGAAAAATGGCTGGTGGACCAAGAGCAACTGGGCATTTCTGAATGAACCGCCGGTGATAGAAGCTGCTTCCAACGAGTATGCGTCACAGTTTCACGTGGCCAACTTGGGGTCAACGAAATTTAACCCCGGAGATGGAATTAGTGCTTGA
Predicted protein sequences of Glyma06g03420
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g03420.1 sequence type=predicted peptide gene model=Glyma06g03420 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MGSLMAGWDSLILDPESATIERNRSLTKEEIDAYWRAKKETELEHLRAISKLSETIQTRKCEDSENSHKSSTVTLASIKESLGMDVDQKSLEQLIKKNGWWTKSNWAFLNEPPVIEAASNEYASQFHVANLGSTKFNPGDGISA*