SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g03380

Feature Type:gene_model
Chromosome:Gm06
Start:2389552
stop:2393494
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g03380
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G47260AT Annotation by Michelle Graham. TAIR10: gamma carbonic anhydrase 2 | chr1:17321384-17323347 REVERSE LENGTH=278 SoyBaseE_val: 6.00E-168ISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0009901GO-bp Annotation by Michelle Graham. GO Biological Process: anther dehiscence SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0070207GO-bp Annotation by Michelle Graham. GO Biological Process: protein homotrimerization SoyBaseN/AISS
GO:2000377GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of reactive oxygen species metabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005747GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex I SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0031966GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial membrane SoyBaseN/AISS
GO:0045271GO-cc Annotation by Michelle Graham. GO Cellular Compartment: respiratory chain complex I SoyBaseN/AISS
GO:0004089GO-mf Annotation by Michelle Graham. GO Molecular Function: carbonate dehydratase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR22572Panther SUGAR-1-PHOSPHATE GUANYL TRANSFERASE JGI ISS
PTHR22572:SF47Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_B9R7W9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein yrdA, putative n=1 Tax=Ricinus communis RepID=B9R7W9_RICCO SoyBaseE_val: 2.00E-174ISS
UniRef100_C6TKS1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TKS1_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma06g03380
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g03380
ParalogEvidenceComments
Glyma04g03310 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g03380 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g030700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g03380
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g03380
>Glyma06g03380.1   sequence type=CDS   gene model=Glyma06g03380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAACCCTTGGGAGAGCGATCTACAGCGTTGGTAACTGGATTCGAGGGACTGGACAGGCCATTGATCGTCTCGGTTCCCTCCTCCAGGGCGGTTACTACGTCCAAGAGCAGCTGTCTAGGCATCGAACTCTGATGGACATATTTGATAAGGCTCCTGTTGTTGATGAGGATGTATTTGTTGCGCCTAGTGCCTCCGTCATTGGAGACGTTCAACTTGGAAGAGGATCATCCATTTGGTATGGAGTTGTCTTGAGGGGTGATGTTAACAGCATCAGAGTTGGAACTGGAACTAACATACAGGACAACTCTCTGGTGCATGTTGCAAAGTCAAATTTAAGTGGGAAGGTGTTGCCTACAATTATTGGGAATAATGTTACTGTCGGCCACAGTGCTGTTATCCATGGTTGTACTGTTGAGGATGAGGCTTTTGTTGGTATGGGTGCAATACTACTTGATGGTGTAGTTGTTGAGAAAAATGCCATGGTTGCTGCTGGAGCCCTTGTCAGACAGAATACAAGGATTCCTTCTGGGGAGGTATGGGCAGGCAATCCCGCAAAGTTCCTGAGAAAGCTCACTGATGAAGAGATAGCTTTCATCTCCCAGTCAGCCACCAATTATACTAACCTTGCACAAGTCCATGCATCTGAAAATTCAAAGTCTTATGATGAAATTGAGTTTGAGAAGGTGCTGCGAAAAAAGTATGCACGTAAAGATGAGGAGTATGACTCTATGCTGGGTGTTGTTCGTGAGATCCCACCGGAGCTTATTCTTCCTGATAATGTCTTACCTGATAAAGCAGAAAAAGCTCTTAAAAAATGA
Predicted protein sequences of Glyma06g03380
>Glyma06g03380.1   sequence type=predicted peptide   gene model=Glyma06g03380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGTLGRAIYSVGNWIRGTGQAIDRLGSLLQGGYYVQEQLSRHRTLMDIFDKAPVVDEDVFVAPSASVIGDVQLGRGSSIWYGVVLRGDVNSIRVGTGTNIQDNSLVHVAKSNLSGKVLPTIIGNNVTVGHSAVIHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTRIPSGEVWAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHASENSKSYDEIEFEKVLRKKYARKDEEYDSMLGVVREIPPELILPDNVLPDKAEKALKK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo