SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g03370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g03370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g03370

Feature Type:gene_model
Chromosome:Gm06
Start:2387510
stop:2388478
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G19580AT Annotation by Michelle Graham. TAIR10: gamma carbonic anhydrase 1 | chr1:6774937-6777092 FORWARD LENGTH=275 SoyBaseE_val: 1.00E-33ISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005747GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex I SoyBaseN/AISS
GO:0031966GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial membrane SoyBaseN/AISS
GO:0045271GO-cc Annotation by Michelle Graham. GO Cellular Compartment: respiratory chain complex I SoyBaseN/AISS
GO:0004089GO-mf Annotation by Michelle Graham. GO Molecular Function: carbonate dehydratase activity SoyBaseN/AISS
GO:0016740GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity SoyBaseN/AISS
PTHR22572Panther SUGAR-1-PHOSPHATE GUANYL TRANSFERASE JGI ISS
PTHR22572:SF47Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_B9R7W8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein yrdA, putative n=1 Tax=Ricinus communis RepID=B9R7W8_RICCO SoyBaseE_val: 1.00E-36ISS
UniRef100_I1JT95UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JT95_SOYBN SoyBaseE_val: 3.00E-37ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g03370 not represented in the dataset

Glyma06g03370 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g03370.1   sequence type=CDS   gene model=Glyma06g03370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAGCCTTGGTTTCTGGATTCGAGAGACTGACTGGCATCGAACTTTGATGAACGTATTTGATAAGGCTCCTGTCGTTGATAAGGATGCATTTGTTGCTCCAAGTGCCTCCGTCATTGGAATAGGATCATCCATTTGGTATGGATGTGTCTTGAGAGATATTTTAAGTTCTAAGGTATGGGCAGGCAATCCCGCAAAGTTCCTAAGAAAGCTAGCTGATGAACAGAAAGCTTTCATCTCCCAGTCAGCCACCAATTATACTAACCTTGCACAGGTCCACGCAGCCGAGAATTCAAAGCCCTTTGATGAAATTGACTTTGAGAAGGTGCTGCGAAAGAAGTTTGCACGTATAGATGAGGAGTACGACTCTATGCTAGGTGTTGTT

>Glyma06g03370.1   sequence type=predicted peptide   gene model=Glyma06g03370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSLGFWIRETDWHRTLMNVFDKAPVVDKDAFVAPSASVIGIGSSIWYGCVLRDILSSKVWAGNPAKFLRKLADEQKAFISQSATNYTNLAQVHAAENSKPFDEIDFEKVLRKKFARIDEEYDSMLGVV







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo