Report for Sequence Feature Glyma06g03050
Feature Type: gene_model
Chromosome: Gm06
Start: 2137795
stop: 2139746
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g03050
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G39090 AT
Annotation by Michelle Graham. TAIR10: Papain family cysteine protease | chr4:18215826-18217326 REVERSE LENGTH=368
SoyBase E_val: 0 ISS
GO:0006096 GO-bp
Annotation by Michelle Graham. GO Biological Process: glycolysis
SoyBase N/A ISS
GO:0006508 GO-bp
Annotation by Michelle Graham. GO Biological Process: proteolysis
SoyBase N/A ISS
GO:0006833 GO-bp
Annotation by Michelle Graham. GO Biological Process: water transport
SoyBase N/A ISS
GO:0006970 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to osmotic stress
SoyBase N/A ISS
GO:0006972 GO-bp
Annotation by Michelle Graham. GO Biological Process: hyperosmotic response
SoyBase N/A ISS
GO:0007030 GO-bp
Annotation by Michelle Graham. GO Biological Process: Golgi organization
SoyBase N/A ISS
GO:0009266 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus
SoyBase N/A ISS
GO:0009269 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to desiccation
SoyBase N/A ISS
GO:0009414 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to water deprivation
SoyBase N/A ISS
GO:0009651 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to salt stress
SoyBase N/A ISS
GO:0042742 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to bacterium
SoyBase N/A ISS
GO:0046686 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to cadmium ion
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005773 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: vacuole
SoyBase N/A ISS
GO:0004197 GO-mf
Annotation by Michelle Graham. GO Molecular Function: cysteine-type endopeptidase activity
SoyBase N/A ISS
GO:0008234 GO-mf
Annotation by Michelle Graham. GO Molecular Function: cysteine-type peptidase activity
SoyBase N/A ISS
KOG1542
KOG
Cysteine proteinase Cathepsin F
JGI ISS
PTHR12411 Panther
CYSTEINE PROTEASE FAMILY C1-RELATED
JGI ISS
PTHR12411:SF42 Panther
CATHEPSIN-W-RELATED
JGI ISS
PF00112 PFAM
Papain family cysteine protease
JGI ISS
PF08246 PFAM
Cathepsin propeptide inhibitor domain (I29)
JGI ISS
UniRef100_C6TDZ7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TDZ7_SOYBN
SoyBase E_val: 0 ISS
UniRef100_E6NU68 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: JHL18I08.12 protein n=1 Tax=Jatropha curcas RepID=E6NU68_9ROSI
SoyBase E_val: 0 ISS
Expression Patterns of Glyma06g03050
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma06g03050
Paralog Evidence Comments
Glyma04g03020 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g03050 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g027700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g03050
Coding sequences of Glyma06g03050
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g03050.1 sequence type=CDS gene model=Glyma06g03050 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTAATCCCTCACTCTTGTTCTTCAGTCTCCTCCTATTATCCGCCACCGTAGCCGCCGCCGAACGGATCGACGATGAAGACGACCTTCTGATCCGTCAAGTGGTGCCGGATGCGGAGGACCACCACCTGCTCAACGCGGAGCACCACTTCTCCGCCTTCAAGACAAAGTTCGGCAAGACCTACGCCACGCAGGAGGAGCACGACCACCGCTTCCGTATCTTCAAGAACAACTTGCTCCGCGCCAAGTCACACCAGAAATTGGATCCCTCCGCCGTCCACGGCGTCACCAGGTTCTCCGATCTCACTCCGGCGGAGTTTCGCCGCCAGTTCCTCGGCCTGAAGCCGCTCCGCCTTCCCTCTGACGCTCAGAAGGCTCCGATCCTACCGACCAACGACCTCCCTACCGATTTCGATTGGCGCGAACATGGAGCCGTTACTGGAGTAAAAAATCAGGGTTCGTGCGGATCGTGTTGGTCCTTTAGCGCCGTTGGAGCGTTGGAAGGTGCTCATTTTCTTTCTACAGGTGAGCTCGTGAGCCTTAGCGAGCAACAACTTGTGGATTGCGATCATGAGTGTGATCCGGAAGAGCGTGGAGCATGTGACTCGGGTTGTAACGGTGGGTTGATGACCACTGCATTTGAGTACACACTCCAGGCTGGTGGACTAATGCGAGAAAAGGATTATCCTTACACTGGAAGAGACCGTGGTCCCTGCAAATTTGACAAGAGCAAAGTTGCTGCTTCCGTAGCTAACTTCAGTGTGGTTTCCCTTGATGAAGAACAAATTGCAGCAAATTTGGTCCAGAATGGTCCTCTTGCAGTTGGTATCAATGCAGTTTTTATGCAGACATATATTGGTGGCGTCTCATGCCCATATATCTGCGGCAAGCATTTGGATCACGGGGTTCTTTTGGTGGGGTATGGTTCTGGTGCTTATGCTCCAATTCGTTTTAAGGAAAAGCCTTACTGGATCATAAAGAATTCATGGGGGGAGAGCTGGGGAGAAGAGGGATATTACAAGATCTGCAGAGGTCGCAATGTATGTGGGGTGGACTCGATGGTCTCAACTGTCGCTGCTATACATGTTTCTAACAATTAA
Predicted protein sequences of Glyma06g03050
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g03050.1 sequence type=predicted peptide gene model=Glyma06g03050 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MANPSLLFFSLLLLSATVAAAERIDDEDDLLIRQVVPDAEDHHLLNAEHHFSAFKTKFGKTYATQEEHDHRFRIFKNNLLRAKSHQKLDPSAVHGVTRFSDLTPAEFRRQFLGLKPLRLPSDAQKAPILPTNDLPTDFDWREHGAVTGVKNQGSCGSCWSFSAVGALEGAHFLSTGELVSLSEQQLVDCDHECDPEERGACDSGCNGGLMTTAFEYTLQAGGLMREKDYPYTGRDRGPCKFDKSKVAASVANFSVVSLDEEQIAANLVQNGPLAVGINAVFMQTYIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAIHVSNN*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
