Glyma06g03015 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g03015

Feature Type:	gene_model
Chromosome:	Gm06
Start:	2101017
stop:	2104330
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g03015

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G62280	AT	Annotation by Michelle Graham. TAIR10: SLAC1 homologue 1 \| chr1:23007309-23008540 REVERSE LENGTH=385	SoyBase	E_val: 2.00E-100	ISS
GO:0006873	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular ion homeostasis	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
PF03595	PFAM	C4-dicarboxylate transporter/malic acid transport protein	JGI		ISS
UniRef100_E6NU71	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: JHL18I08.15 protein n=1 Tax=Jatropha curcas RepID=E6NU71_9ROSI	SoyBase	E_val: 1.00E-128	ISS
UniRef100_UPI00023398EB	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00023398EB related cluster n=1 Tax=unknown RepID=UPI00023398EB	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma06g03015

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g03015 not represented in the dataset	Glyma06g03015 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g03015

Paralog	Evidence	Comments
Glyma04g02990	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g03015 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g027400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g03015

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g03015

Limit To All Plant Sequences

>Glyma06g03015.1   sequence type=CDS   gene model=Glyma06g03015   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTCGCAAAGCGCTCCTTAACGTCCCTAAATTCTATACTAACAAAATTCCATGCAGGTTACTTCAGAATAAGCCTCTCCCTCGGTGGCCAAGCTTTGTGGTGGAAGACACTGATCGAATCACCAACACACGACGTCACAAGCGCTCTACGACGCTTGCTTTGCACGCTTCCTTCCTCAGCTTTTCTTGCACTGTGGTCGTTGGCTCTCTTTACTCTCGTGTTACTCTCTCTTCTCTACCTCCTGAGATGCTTAATTGCGGATTTCTTGCACCCTGTACGAGTTAACTACCTCTTCGCTCCGTGGATTTCATGGCTTCTGTTGCTTCAATCAGCGCCATTCGTGGCGCCGAAAACACCGACGTATTTGGTTATGTGGTGGGTGTTCGCGGTGCCGGTGGTGGTGCTGGACGTGAAATTCTACGGGCAGATGTCGGTGATAGGGAACTTGGTCGGGGCACAAGCTGCGGCGAATATGGGTTGGAAAGAGAGAGCGGTTTGCTTGTTTTCGCTGGGGATGGTGCATTACTTGGTGCTGTTTGTTACCCTCTATCAGCGTTCCGGTGGAGATCGCCTTCCGGTGTTGTTGAGGCCGGTTTTCTTCTTGTTCTTTGCAGCACCGAGTGTGGCAAGCTTGGCTTCAGAATTCATGGTTGGCACCTTTGATACTGCTTCCAAGATGCTCTTCTTTCTCTCCCTAGTCCTCTTCACATCACTGATTTGCAGGCCAACCCTGTTCAGGAGATCTATGAGAAGGCTCAATGTTGCGTGGTGGGCTTACTCCTTTCCGATTACCGCACTAGCTCTGCTTTCAACGAATTATATGCACCTTCTGTTAGCTCTTTCAGTTCTTGTCTACCTTTTTCTAACGTTCTTCACTCTGCTCAACTCTAAGATGCTTCTACCAGATAACGATCCTATTATTGCAAGCTTGCTCATTAGTTAA

Predicted protein sequences of Glyma06g03015

Limit To All Plant Sequences

>Glyma06g03015.1   sequence type=predicted peptide   gene model=Glyma06g03015   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVAKRSLTSLNSILTKFHAGYFRISLSLGGQALWWKTLIESPTHDVTSALRRLLCTLPSSAFLALWSLALFTLVLLSLLYLLRCLIADFLHPVRVNYLFAPWISWLLLLQSAPFVAPKTPTYLVMWWVFAVPVVVLDVKFYGQMSVIGNLVGAQAAANMGWKERAVCLFSLGMVHYLVLFVTLYQRSGGDRLPVLLRPVFFLFFAAPSVASLASEFMVGTFDTASKMLFFLSLVLFTSLICRPTLFRRSMRRLNVAWWAYSFPITALALLSTNYMHLLLALSVLVYLFLTFFTLLNSKMLLPDNDPIIASLLIS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain