SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g02770

Feature Type:gene_model
Chromosome:Gm06
Start:1870333
stop:1873280
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g02770
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G28305AT Annotation by Michelle Graham. TAIR10: Putative lysine decarboxylase family protein | chr2:12081186-12084307 FORWARD LENGTH=213 SoyBaseE_val: 1.00E-112ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF03641PFAM Possible lysine decarboxylase JGI ISS
UniRef100_G7J4P9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Carboxy-lyase n=1 Tax=Medicago truncatula RepID=G7J4P9_MEDTR SoyBaseE_val: 3.00E-148ISS
UniRef100_UPI0001B8379AUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001B8379A related cluster n=1 Tax=unknown RepID=UPI0001B8379A SoyBaseE_val: 3.00E-162ISS

Expression Patterns of Glyma06g02770
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g02770
ParalogEvidenceComments
Glyma04g02750 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g02770 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g025200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g02770
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g02770
>Glyma06g02770.1   sequence type=CDS   gene model=Glyma06g02770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAACTCAACACCAACAACCCACCATCAAGTCTAGGTTCAGACGCATCTGTGTCTACTGTGGTAGCAGCCCTGGCAAAAACCCCAGCTACCAGCTCGCTGCTATTCAACTCGGAAAACAACTGGTGGAGAGGAACATTGACTTGGTTTATGGAGGAGGAAGCATAGGGTTGATGGGTCTAATCTCACAAGTTGTGTATGATGGTGGACGCCACGTGTTAGGGGTGATTCCAGAGACACTTAATGCAAGAGAGATAACTGGAGAGAGTGTTGGAGAAGTGAGAGCTGTATCGGGCATGCACCAACGCAAAGCCGAAATGGCCCGACAAGCCGATGCATTTATTGCACTGCCAGGTGGATATGGCACCCTTGAAGAACTACTGGAAATTATCACCTGGGCTCAACTAGGCATCCATGATAAACCGGTGGGGTTGTTGAACGTGGATGGGTACTACAACTCGCTGCTGGCATTCATGGACAAAGCTGTGGACGAAGGTTTCGTAACACCAGCTGCCCGTCACATTATTGTTTCTGCCCACACTGCCCAAGAACTCATGTGCAAACTTGAGGAATATGTCCCCGAGCACTGTGGCGTGGCCCCCAAGCTAAGTTGGGAGATGGAGCAACAGTTAGTTAACACTGCAAAGTCAGATATTTCCCGTTGA
Predicted protein sequences of Glyma06g02770
>Glyma06g02770.1   sequence type=predicted peptide   gene model=Glyma06g02770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
METQHQQPTIKSRFRRICVYCGSSPGKNPSYQLAAIQLGKQLVERNIDLVYGGGSIGLMGLISQVVYDGGRHVLGVIPETLNAREITGESVGEVRAVSGMHQRKAEMARQADAFIALPGGYGTLEELLEIITWAQLGIHDKPVGLLNVDGYYNSLLAFMDKAVDEGFVTPAARHIIVSAHTAQELMCKLEEYVPEHCGVAPKLSWEMEQQLVNTAKSDISR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo