Report for Sequence Feature Glyma06g02661
Feature Type: gene_model
Chromosome: Gm06
Start: 1796812
stop: 1798009
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g02661
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_G7I779 UniRef
Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=G7I779_MEDTR
SoyBase E_val: 4.00E-10 ISS
Expression Patterns of Glyma06g02661
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma06g02661
Paralog Evidence Comments
Glyma04g02621 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g02661 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g024200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g02661
Coding sequences of Glyma06g02661
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g02661.1 sequence type=CDS gene model=Glyma06g02661 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAGAAGGAGTACAATTTAAAGTTGAAGGCAAGGAAACAAGAGCTAAGTCAAGGTGGTCTCGTTCACAAGCAAGCACAACAGCAATTCCAATTTTCAGGCATGGCGCATCATCCACCGTTGATCTTGAATCAGACGGCTGGATCAGGCCAAATAAAAGGCGGCGAGGGAGTTGTTGGTCTTGCTCACGCAACGACGTCGTTGGGAGTGGCATCCTTAAGTAGCAGTAATAATGTGGGCCCAGTTGGAATTCCCGATCTGAACCTGCCACTCGATGAGCCCATGACAATGGAGTTTTGTGAAGCGTTGGATATGAACGTGGCCGATAAGAATCTGAGTAGGTCCATGGCAGCTGCTCAGGCCCGCCAGAATAGGCTTCAAAAATACAGGTTCAAGAATCCAATTGGAATTAGTAAACCCCGTTACTCTTGTAGATGA
Predicted protein sequences of Glyma06g02661
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g02661.1 sequence type=predicted peptide gene model=Glyma06g02661 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKKEYNLKLKARKQELSQGGLVHKQAQQQFQFSGMAHHPPLILNQTAGSGQIKGGEGVVGLAHATTSLGVASLSSSNNVGPVGIPDLNLPLDEPMTMEFCEALDMNVADKNLSRSMAAAQARQNRLQKYRFKNPIGISKPRYSCR*