SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g02650

Feature Type:gene_model
Chromosome:Gm06
Start:1788839
stop:1792899
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g02650
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G75780AT Annotation by Michelle Graham. TAIR10: tubulin beta-1 chain | chr1:28451378-28453602 REVERSE LENGTH=447 SoyBaseE_val: 0ISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006184GO-bp Annotation by Michelle Graham. GO Biological Process: GTP catabolic process SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0007017GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule-based process SoyBaseN/AISS
GO:0007018GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule-based movement SoyBaseN/AISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009826GO-bp Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0010817GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0051258GO-bp Annotation by Michelle Graham. GO Biological Process: protein polymerization SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005874GO-cc Annotation by Michelle Graham. GO Cellular Compartment: microtubule SoyBaseN/AISS
GO:0003924GO-mf Annotation by Michelle Graham. GO Molecular Function: GTPase activity SoyBaseN/AISS
GO:0005198GO-mf Annotation by Michelle Graham. GO Molecular Function: structural molecule activity SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG1375 KOG Beta tubulin JGI ISS
PTHR11588Panther TUBULIN JGI ISS
PF00091PFAM Tubulin/FtsZ family, GTPase domain JGI ISS
PF03953PFAM Tubulin C-terminal domain JGI ISS
UniRef100_B9R897UniRef Annotation by Michelle Graham. Most informative UniRef hit: Tubulin beta chain, putative n=1 Tax=Ricinus communis RepID=B9R897_RICCO SoyBaseE_val: 0ISS
UniRef100_I1K7J4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K7J4_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma06g02650
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g02650
ParalogEvidenceComments
Glyma04g02610 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g02650 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g024100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g02650
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g02650
>Glyma06g02650.1   sequence type=CDS   gene model=Glyma06g02650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGAGAGATCCTGCACGTTCAGGGAGGCCAATGCGGTAACCAAATCGGTTCCAAGTTCTGGGAGGTGATATGCGACGAGCACGGCATCGATCCTACCGGAAAGTACAACGACGAAGGCAACAGCGGCATCCAACTCGAGAGGATCAATGTCTATTACAATGAGGCCTCTGGCGGAAGGTACGTTCCGAGAGCCGTGCTTATGGATCTCGAACCTGGAACCATGGACAGCATCAGATCTGGCCCCTACGGCAAGATCTTCCGCCCTGACAACTTCGTCTTCGGCCAGTCCGGCGCCGGTAACAATTGGGCCAAAGGTCATTACACCGAAGGCGCCGAGCTGATCGACTCCGTTCTCGATGTCGTTCGCAAAGAGGCTGAAAACTGCGATTGCCTGCAAGGTTTTCAAGTTTGCCACTCTCTTGGAGGAGGCACAGGTTCTGGCATGGGAACACTGTTGATATCAAAAATTAGGGAGGAATACCCAGACAGAATGATGCTCACTTTCTCTGTTTTCCCATCTCCAAAAGTTTCTGACACAGTTGTGGAGCCATACAATGCCACTTTGTCTGTACACCAACTGGTTGAAAATGCAGATGAATGCATGGTTCTTGACAATGAAGCACTTTATGACATTTGCTTTAGGACATTGAAACTCAGCACCCCTAGCTTTGGTGATCTCAACCATCTGATTTCTGCGACCATGAGTGGGGTTACCTGTTGTCTGAGGTTTCCTGGACAACTGAACTCTGACCTCAGGAAGCTGGCTGTCAATCTGATTCCATTTCCCCGTCTTCACTTCTTTATGGTGGGGTTTGCACCTCTCACTTCTCGTGGGTCTCAGCAATATGTCTCCCTTACTGTCCCAGAGCTGACTCAACAAATGTGGGATGCCAAAAATATGATGTGTGCTGCTGATCCCCGACACGGCCGATACTTGACTGCATCTGCTATGTTCAGGGGAAAGATGAGCACCAAAGAGGTTGATGAACAAATGATCAATGTGCAGAACAAGAACTCATCATACTTTGTTGAATGGATTCCCAACAATGTGAAGTCCAGTGTGTGTGATATTCCACCCAGGAATTTGAAGATGTCATCCACCTTTATTGGGAACTCGACATCAATTCAAGAGATGTTTAGGAGGGTCAGTGAGCAGTTCACTGCTATGTACCGGCGCAAAGCCTTCTTGCATTGGTACACTGGGGAGGGTATGGACGAGATGGAGTTCACTGAGGCAGAGAGTAATATGAATGATTTGGTAGCAGAGTACCAGCAGTACCAGGATGCAACCGCAGAGGAGGATGATGAATACGAGGATGAAGGTGAGGAGCAGTATGTTGAATAG
Predicted protein sequences of Glyma06g02650
>Glyma06g02650.1   sequence type=predicted peptide   gene model=Glyma06g02650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MREILHVQGGQCGNQIGSKFWEVICDEHGIDPTGKYNDEGNSGIQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGKIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLNHLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYVSLTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRNLKMSSTFIGNSTSIQEMFRRVSEQFTAMYRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDATAEEDDEYEDEGEEQYVE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo