Glyma06g02560 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g02560

Feature Type:	gene_model
Chromosome:	Gm06
Start:	1713898
stop:	1715887
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g02560

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G42150	AT	Annotation by Michelle Graham. TAIR10: Glutathione S-transferase family protein \| chr5:16846247-16847909 FORWARD LENGTH=315	SoyBase	E_val: 1.00E-25	ISS
GO:0006626	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion	SoyBase	N/A	ISS
GO:0009407	GO-bp	Annotation by Michelle Graham. GO Biological Process: toxin catabolic process	SoyBase	N/A	ISS
GO:0010583	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone	SoyBase	N/A	ISS
GO:0045454	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0015035	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity	SoyBase	N/A	ISS
PTHR12782	Panther	MICROSOMAL PROSTAGLANDIN E SYNTHASE-2	JGI		ISS
PTHR12782:SF5	Panther	SUBFAMILY NOT NAMED	JGI		ISS
UniRef100_G7J598	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Prostaglandin E synthase n=1 Tax=Medicago truncatula RepID=G7J598_MEDTR	SoyBase	E_val: 3.00E-38	ISS
UniRef100_UPI00023398D8	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00023398D8 related cluster n=1 Tax=unknown RepID=UPI00023398D8	SoyBase	E_val: 8.00E-51	ISS

Expression Patterns of Glyma06g02560

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g02560

Paralog	Evidence	Comments
Glyma04g02520	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g02560 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g023100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g02560

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g02560

Limit To All Plant Sequences

>Glyma06g02560.1   sequence type=CDS   gene model=Glyma06g02560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTCGACTCTTCAGACATAATTGATAAATTGATCAAAAGGATACATCCAGATTATGACCTAAATGCACAAGAAGAGAACAAGTGGCGATACTATCACATCGGGTTACATCTGATGTCATTATTAGGAGTTTGTGCTCTTGAATCATTTGATTATATCACCACCCAAGACATGTATGGGACATTTTCATTTTATCCTAATTTCATATTGCTTGAAATCAGTGTTTTCCTCTGTCATTTTCTTAATATGGAGAAAGTTCTGAAAATTCTGTCGTTTTCAGTTAGGTCATGCAAAGTTGATTATTCTGTATGGGGCTGCGGCTATGTATTTTGTGTCAAAGAAATTTTAGCAGATCTTGCTGTGTTTGGTGTTCTAAGACCCATCCACCATCTCAAGTCAGGTAGAGATATAATAGAGCACGCCCTGATTGGGAAATGGTTTTCTGAGATGGATCTTGCAGTAGGACAGTCTTCTAGGGTGAGTGAGCATAGCTAG

Predicted protein sequences of Glyma06g02560

Limit To All Plant Sequences

>Glyma06g02560.1   sequence type=predicted peptide   gene model=Glyma06g02560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVDSSDIIDKLIKRIHPDYDLNAQEENKWRYYHIGLHLMSLLGVCALESFDYITTQDMYGTFSFYPNFILLEISVFLCHFLNMEKVLKILSFSVRSCKVDYSVWGCGYVFCVKEILADLAVFGVLRPIHHLKSGRDIIEHALIGKWFSEMDLAVGQSSRVSEHS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain