SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma06g02491

Feature Type:gene_model
Chromosome:Gm06
Start:1661235
stop:1661738
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G20160AT Annotation by Michelle Graham. TAIR10: Subtilisin-like serine endopeptidase family protein | chr1:6990852-6993737 REVERSE LENGTH=730 SoyBaseE_val: 5.00E-31ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0043086GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of catalytic activity SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0004252GO-mf Annotation by Michelle Graham. GO Molecular Function: serine-type endopeptidase activity SoyBaseN/AISS
GO:0042802GO-mf Annotation by Michelle Graham. GO Molecular Function: identical protein binding SoyBaseN/AISS
PTHR10795Panther SUBTILISIN/KEXIN-RELATED SERINE PROTEASE JGI ISS
PTHR10795:SF17Panther gb def: possible protease [sinorhizobium meliloti] JGI ISS
UniRef100_I1JT11UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JT11_SOYBN SoyBaseE_val: 3.00E-46ISS
UniRef100_Q93WQ0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Subtilisin-type protease n=1 Tax=Glycine max RepID=Q93WQ0_SOYBN SoyBaseE_val: 1.00E-39ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g02491 not represented in the dataset

Glyma06g02491 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g02458 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g02491.1   sequence type=CDS   gene model=Glyma06g02491   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAGAATTGGGATCATTAGCCACACCTTATGACTATGGAGCAGGGGCAATTACAACATCTGAACCATGGCTAGTTTATGAAACCACCACCTTTGATTACTTGAACTATTTGTGTTACAATGGACTTAACATAACCATGGTCAAGGTCATCTCCGGAACTGTCCCCGACAATTTCAATTGCCCCAAGGATTCGAACTCTGATCTAATATCCAACATCAATTACCCTTCCATAGCAGTAAACTTCACTGGCAAAGCAAACGTGGTCGTGAGTAGAACTGTCACAAGCGTTGGAGAAGAAGTGAAACAGTGTACTTCCCCGTTGTTGAAGCTCTCAAAGGAGTATTTGTCACATTAA

>Glyma06g02491.1   sequence type=predicted peptide   gene model=Glyma06g02491   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTELGSLATPYDYGAGAITTSEPWLVYETTTFDYLNYLCYNGLNITMVKVISGTVPDNFNCPKDSNSDLISNINYPSIAVNFTGKANVVVSRTVTSVGEEVKQCTSPLLKLSKEYLSH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo