SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g02470

Feature Type:gene_model
Chromosome:Gm06
Start:1639376
stop:1641643
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g02470
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G35900AT Annotation by Michelle Graham. TAIR10: Basic-leucine zipper (bZIP) transcription factor family protein | chr4:17004746-17005952 FORWARD LENGTH=285 SoyBaseE_val: 5.00E-15ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009410GO-bp Annotation by Michelle Graham. GO Biological Process: response to xenobiotic stimulus SoyBaseN/AISS
GO:0009648GO-bp Annotation by Michelle Graham. GO Biological Process: photoperiodism SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009911GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flower development SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0048573GO-bp Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
PTHR22952Panther CAMP-RESPONSE ELEMENT BINDING PROTEIN-RELATED JGI ISS
PTHR22952:SF45Panther SUBFAMILY NOT NAMED JGI ISS
PF00170PFAM bZIP transcription factor JGI ISS
UniRef100_A4ZGR4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor bZIP47 (Fragment) n=1 Tax=Glycine max RepID=A4ZGR4_SOYBN SoyBaseE_val: 6.00E-117ISS
UniRef100_A4ZGR4UniRef Annotation by Michelle Graham. Best UniRef hit: Transcription factor bZIP47 (Fragment) n=1 Tax=Glycine max RepID=A4ZGR4_SOYBN SoyBaseE_val: 6.00E-117ISS

Proteins Associated with Glyma06g02470
LocusGene SymbolProtein Name
FDL0602 Flowering Locus D-like gene 602

Expression Patterns of Glyma06g02470
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g02470
ParalogEvidenceComments
Glyma04g02420 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g02470 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g022300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g02470
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g02470
>Glyma06g02470.2   sequence type=CDS   gene model=Glyma06g02470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAGACGATATCCAGGTGGTGGTTTAATTGTGTGGGGACATGAACCTGGGACCTCCTTGTCAACCCTAAATGTGGAAATACCCTTGTCATTGGCAAAAGTAGAAAAAAAAGAAGAAGGGGGTGAAGCATGGCCTCGTGGCCACCCAAACCTGCAGAGATATTTTGTTCGTTTGAGTGTGAGAGAGAAAGCGATGGCCTCATCACCATGTGATTGCTGGCCCCATTCTTCTTCTTCTTCTTCTTCTTCCATTGAACATGTCTGGAACGACATCAAACTCGCCTCTCTCTCCAATTCCTCCGTTGACTTAGACTTGAACAACAACAACCACTCTGTCTCCGTTTCTTCTTTCCTTAACCAACCTCTTTCCACTTTTCTCACTCTCACTTCTACTTCCTCTTCCTCCTCTGTCTTTCACAAACATGACCACTCTCTTCTCTCTGTCTCCGACCCCAACACCCTGCAAGATCAACGCCATACGCGTGTGATCAAGAATCGAGAATCCGCGGTTCGGTCCAGAGCCAGAAAACAGGCTTATAGAAAAGGCTTGGAAGTTGAAATTTCCCGTTTAACGGAAGAGAATTCCAGACTAAAAAGACAATTGAAAGAGTTGCAGCGCTGTTTGTGCTCCTCTCACACTCCCAGAATGGCCGCTCCGTGTAGAACCTCTTCATCTCCATTTTGA
Predicted protein sequences of Glyma06g02470
>Glyma06g02470.2   sequence type=predicted peptide   gene model=Glyma06g02470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRRYPGGGLIVWGHEPGTSLSTLNVEIPLSLAKVEKKEEGGEAWPRGHPNLQRYFVRLSVREKAMASSPCDCWPHSSSSSSSSIEHVWNDIKLASLSNSSVDLDLNNNNHSVSVSSFLNQPLSTFLTLTSTSSSSSVFHKHDHSLLSVSDPNTLQDQRHTRVIKNRESAVRSRARKQAYRKGLEVEISRLTEENSRLKRQLKELQRCLCSSHTPRMAAPCRTSSSPF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo