Glyma06g02373 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g02373

Feature Type:	gene_model
Chromosome:	Gm06
Start:	1577968
stop:	1580225
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g02373

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G76050	AT	Annotation by Michelle Graham. TAIR10: Pseudouridine synthase family protein \| chr1:28540858-28542019 FORWARD LENGTH=313	SoyBase	E_val: 6.00E-84	ISS
GO:0001522	GO-bp	Annotation by Michelle Graham. GO Biological Process: pseudouridine synthesis	SoyBase	N/A	ISS
GO:0009451	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA modification	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
GO:0009982	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pseudouridine synthase activity	SoyBase	N/A	ISS
PTHR10436	Panther	RIBOSOMAL PSEUDOURIDINE SYNTHASE	JGI		ISS
PTHR10436:SF39	Panther	RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D	JGI		ISS
PF00849	PFAM	RNA pseudouridylate synthase	JGI		ISS
UniRef100_G7J5V2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: RNA pseudourine synthase n=1 Tax=Medicago truncatula RepID=G7J5V2_MEDTR	SoyBase	E_val: 5.00E-117	ISS
UniRef100_I1K7G5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1K7G5_SOYBN	SoyBase	E_val: 9.00E-180	ISS

Expression Patterns of Glyma06g02373

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g02373 not represented in the dataset	Glyma06g02373 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g02373

Paralog	Evidence	Comments
Glyma04g02320	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g02373 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma06g02373

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g02373

Limit To All Plant Sequences

>Glyma06g02373.1   sequence type=CDS   gene model=Glyma06g02373   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTTCTCTCTGCTACGAGCTATAAATTTATTTCTGCCACCGCGAGCGCCGCTTCTGGCTCCGCCGGCGACACAGACTCCGATGGAGAGCCAAAATTGAACTTCTCCGGTGTGCGGTTGGAGGAGGCCGTCGATAGCAGAATCGGATCTGGAAAACTCAGACTCGACAACTGGATCTCTTCCCGCATCAATGGCATTCGTAGGGCAAGAGTTCAATCAAGTATCAAATCAGGACTCGTTCATGTCAATGGCCGTGTGGTTGATAAGAATTTGAGGGCTGTGACAGAAAATATACCTTTGGATATAGTTTATGAAGATGAGCATGTTTTAGTCATAAATAAACCTGCACACATGGTAATTCCGAACCTGACTTATTCTCAATTTCATTATTTGGTCAATACATCGGGGATGCTTGTCAATGGTATTCTTCATCATTGCAACCTTCCAAATGTTGAATTTTCTAAAGAGGAGGAAGCTCTTTCAGATACAGAAGATTCTGATGATGAATTCAATAGCTATCGCTCCCTGGCAAGTTTTTGTGAGGGGTTAAATTCTAGACTGTCTGTGGCATCAAATTCAATTCGCTCAGGGATTGTACACAGATTGGACAAAGGCACGAGTGGGTTACCTGTTGCAAAGGATGAACATTCACATATGAAATTGTCAGAGCAATTCAAGCAACATACCATCAAAAGGATTTATGTCAGTCTTACTGCTGGGCTACCCACTCCAGTTGCTGGGCGTGTTGAGGTTCCAGTTGGCCGTGATCCTAATAATCGGATTCGTATGACTGCTGTAGCTGGACCAGTTAATTCTAGAAAGGCCCGTCATGCTGCTAGTAGGTGA

Predicted protein sequences of Glyma06g02373

Limit To All Plant Sequences

>Glyma06g02373.1   sequence type=predicted peptide   gene model=Glyma06g02373   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
FLSATSYKFISATASAASGSAGDTDSDGEPKLNFSGVRLEEAVDSRIGSGKLRLDNWISSRINGIRRARVQSSIKSGLVHVNGRVVDKNLRAVTENIPLDIVYEDEHVLVINKPAHMVIPNLTYSQFHYLVNTSGMLVNGILHHCNLPNVEFSKEEEALSDTEDSDDEFNSYRSLASFCEGLNSRLSVASNSIRSGIVHRLDKGTSGLPVAKDEHSHMKLSEQFKQHTIKRIYVSLTAGLPTPVAGRVEVPVGRDPNNRIRMTAVAGPVNSRKARHAASR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain